KEGG   Bacillus thuringiensis Bt407: BTB_c44970Help
Entry
BTB_c44970        CDS       T02277                                 

Gene name
vpr1
Definition
(GenBank) minor extracellular protease Vpr
  KO
K14647  minor extracellular serine protease Vpr [EC:3.4.21.-]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
btg02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:btg00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BTB_c44970 (vpr1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:btg01002]
    BTB_c44970 (vpr1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:btg03110]
    BTB_c44970 (vpr1)
Enzymes [BR:btg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     BTB_c44970 (vpr1)
Peptidases [BR:btg01002]
 Serine Peptidases
  Family S8: subtilisin family
   BTB_c44970 (vpr1)
Chaperones and folding catalysts [BR:btg03110]
 Intramolecular chaperones
  Subtilisin family
   BTB_c44970 (vpr1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S8 PA Inhibitor_I9 FlgD_ig Cadherin-like FixG_C
Motif
Other DBs
NCBI-ProteinID: AFV20178
Position
4352781..4355534
Genome map
AA seq 917 aa AA seqDB search
MKKTTSTLLSMALVFSSFGALSTHAESLQKEKQFSPQLKTTIEQWGEHKIAQNVETKTTK
EISVIVELQHAPLAAQSNIQHAPDLQNSNAQSYHAELKKAQEDTTKKIKEKAPGAKIKEV
YNTLFSGFSISVPGDQITSLASLPEVKAVYPNLTYKLHETSKSTTNEEAPNIGGPTIGAP
EAWNLKDPSGKPLDGKGMKVAIIDSGVDYTHPDLKANYIGGYDTVDEDSDPMDGNVHGTH
VAGIIAGNGQIKGVAPNASILAYRVMNDGGTGTTDDIIQGIERAIQDGADVLNLSLGQDL
NVPDQPVTLTLERAAKLGVTTVVSNGNDGPKPWSVDAPGNASSVISVGASTVSIPFPTFQ
VAGSSKTYQGLPLSKSDFPIGNDSPLVYVGYGNPSDYAKQDVKGKFALILQGTSSTLVKA
EQAKQAGALGVLLISSEKEMNMMPEYFSREHLAVPVMQLSNTNGEELKTLITKRKKNIKI
GQPKQTELIGNFSSRGPSQGSWLIKPDVVAPGVQITSTVPRGGYESHNGTSMAAPQVAGA
VALLRQMHPDWTTEQLKAALANNAKTLHDVNENTYPVMAQGSGLINIPKAAQTNVLVKPN
NVSFGLIKPNSGKVKLTQNVTLQNLSSKKKSFSTRVELLDANTNTKVKASVPSSISIQPN
SSTEKPFTITVDSSLPQGVYTGNVYVKEQGAKEEIRIPFTFSIDPKDYKRIDGLEIINST
FSPNGDHVLDDNLINYYLVAPVDDVTLHANLVTKERVTYQGIIHQAKNATPGYKPFKWNG
TKTDGTPLADGLYQIEAVASNSGGETKQTAAVFLDRTAPKLTYEVDQENLVIRGKVDDIL
LDWMSESGWIAPGIPVRMQYEINGNGVWDQAFLNPWDKSYDIYFDRTQLQEGKNTIHIVA
TDAAGNTSNLTVNLEVK
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaactacatctacactattaagcatggcgcttgtcttttctagttttggagct
ttaagcactcatgctgaatcactacaaaaggagaagcaatttagtccacaattaaaaaca
acgattgaacagtggggagaacataaaattgctcaaaatgttgaaacgaaaacaacaaaa
gaaatatcagtaattgtagaattgcaacatgcacctctcgctgctcaaagtaatattcag
catgctccagatttacaaaatagtaatgcgcagtcttatcatgctgagctaaaaaaagca
caagaagatacgactaagaaaataaaagaaaaagcacctggtgcaaaaattaaagaagtg
tataatacgttattttccggattctctatttcagttcctggagatcaaattacctctctt
gcctctttacctgaagtaaaagcagtctatccgaacttaacatataaattgcatgaaaca
tcaaaaagtactactaacgaagaagcaccaaatatcggtggaccgacaattggtgcacct
gaagcgtggaatttaaaagatccatctggcaaaccgcttgatggaaaaggcatgaaagta
gccattatcgactctggcgtagactatacacaccctgacttaaaggcaaattatatcggt
ggatatgacacggttgatgaagatagcgatccaatggatggtaacgtacatggtactcat
gtagctggaattattgcgggtaatggacaaattaaaggcgttgctccaaacgcttctatt
ctagcctaccgtgtaatgaatgacggtggaactggtacaacagatgatattatccaaggg
attgagcgagcgattcaagatggtgcagatgtgttaaacctctcccttgggcaggattta
aatgtacctgatcagcctgtaacattaacgttagaacgagcagcgaaacttggtgttact
actgtcgtttcaaatggaaatgacggaccaaaaccttggtctgttgatgctcccggtaac
gcaagtagtgtcatttctgttggagcatctacggtttctatcccgtttccaacattccaa
gtagctggttccagcaaaacatatcaagggttaccgttatcaaaatccgattttccaata
ggaaatgattcccctcttgtatacgttggttatggcaatccaagtgattatgcaaaacaa
gatgtgaaagggaaattcgcacttattttacaaggtacttctagtacattagtaaaagca
gaacaagcgaagcaagctggggcgcttggtgtgttattaatctctagcgaaaaagaaatg
aatatgatgccggaatatttttcacgtgaacatctagctgtcccagtaatgcaattatca
aatacaaatggggaagaattaaaaactttaattacaaaacgaaagaaaaatataaaaatt
ggacaaccaaagcaaacagaacttatcggtaactttagttcaagaggaccatcacaagga
agttggctaataaagcctgatgttgttgcacctggagtacaaattactagtacagtaccg
cgaggcggctatgaatcgcataacggaacaagtatggctgctccgcaagtagctggagcg
gttgccctcttgcgtcaaatgcatcctgattggacgacagaacaattgaaagcggctctt
gctaacaatgcaaaaacattacatgatgtcaatgaaaatacataccctgttatggcacaa
ggatcaggtttaattaacattccgaaagcagctcaaacaaatgtattagtaaaacctaac
aatgtcagctttggtcttattaagccaaatagcggaaaagtaaaactgacgcaaaatgtt
acattacaaaacctttctagtaaaaagaaaagtttttcaactcgtgtggagttactagat
gcaaacacaaacacaaaagtaaaagcttctgtcccttcatcgattagcattcaaccgaat
agtagtaccgaaaaaccatttactatcactgtagatagctcactaccacaaggtgtgtat
actggaaatgtatatgtaaaagaacaaggggcaaaagaagaaattcgaattccattcaca
tttagtatcgatcctaaagattataaacgtatcgatggacttgaaattattaattctact
tttagcccaaatggcgaccacgtactagatgataatctcatcaactactatttagttgcg
cctgtggatgatgtaacattgcatgcaaatttagttacgaaagaacgtgtaacgtatcaa
gggattatccatcaagctaaaaatgcaactcctggatacaaacctttcaaatggaatggt
acaaaaaccgatggaactcctttagctgacgggctatatcaaatcgaagcagttgcttct
aattctggcggagaaacaaaacaaacagctgctgtatttcttgatcgaactgcacctaag
ttaacatacgaagttgaccaagaaaatctcgtaattagaggaaaagttgatgatattcta
ctagattggatgtcagaatctggttggatagcacctggtattccagtgagaatgcaatat
gaaattaacggaaatggtgtatgggaccaggcattcctgaacccttgggataaaagctat
gacatttatttcgatcgtactcaattacaagaaggaaaaaatactattcacattgtagca
actgatgcagctggcaatacctctaatttaactgttaatttagaagtgaaataa

DBGET integrated database retrieval system