KEGG   Bacillus thuringiensis Bt407: BTB_c44980Help
Entry
BTB_c44980        CDS       T02277                                 

Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
btg00360  Phenylalanine metabolism
btg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
btg00790  Folate biosynthesis
btg01100  Metabolic pathways
btg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:btg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    BTB_c44980
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BTB_c44980
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BTB_c44980
Enzymes [BR:btg01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     BTB_c44980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AFV20179
Position
4356425..4358179
Genome map
AA seq 584 aa AA seqDB search
MTKKTEIPSHLKPFVSTQHYDQYTPVNHAVWRYIMRQNHSFLKDVAHPAYVNGLQSSGIN
IDAIPKVEEMNECLAPSGWGAVTIDGLIPGVAFFDFQGHGLLPIATDIRKVENIEYTPAP
DIVHEAAGHAPILLDPTYAKYVKRFGQIGAKAFSTKEEHDAFEAVRTLTIVKESPTSTPD
EVKAAENAVIEKQNLVSGLSEAEQISRLFWWTVEYGLIGNIDDPKIYGAGLLSSVGESKH
CLTDAVEKVPFSIEACIGTTYDVTKMQPQLFVCESFEELTDALETFSKTMAFKTGGKEGL
EKAIRSENYATAELNSGLQITGTFSETIENDAGELIYMRTNSPTALALHNKQLANHSNSV
HSDGFGTPIGLLTENIALENCTDEQLQSLGITIGTIAEFTFASGIHVKGTVTDIVKNDKK
IALISFIDCTVTYNARVLFDASWGAFDMAVGSQITSVFPGAADAAAFFPMDEEVHEIPAP
LVLNELERMYQTVRDIRSEGILHDAHIDQLVAIQEVLNKFYAKEWLLRLEVLELLLEHNK
GHETSAALLHQLSTFTTDEAVTRLINNGLALLPVKDVKNDAKIN
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagaaaacagaaattccatcgcatttaaaaccattcgtatccacacaacattat
gatcaatacacaccggtgaatcacgctgtgtggcgttacattatgagacagaatcatagc
ttcttaaaagacgttgctcatccagcctatgtgaacggactacaatcatctggtattaat
atagatgcaattccaaaagtagaagaaatgaatgagtgtttggcaccaagtggctggggc
gctgtaacgattgacggacttattcccggcgtagcattcttcgattttcaaggacacgga
ttactaccgatcgcaacagatattcggaaagtagaaaatatcgagtacacaccagctcca
gatatcgtacacgaagccgcaggacacgcaccgattttacttgatcctacatatgcaaaa
tatgtgaaacgttttgggcaaattggtgcaaaagctttctctacaaaagaagaacatgat
gcatttgaagctgttcgtacattaacgatagtgaaagaaagccctacttctactcctgat
gaagttaaggctgctgaaaatgctgtaattgaaaaacaaaacttagtttctggtttatca
gaagctgaacaaatttcacgtcttttctggtggacagtagaatatggattgatcggaaat
atagatgatccaaagatatatggtgctggtctcctttcttctgttggcgaaagcaaacat
tgcttaacagacgctgtagaaaaggttccattttctatcgaagcatgtatagggacaact
tatgacgtaacaaaaatgcaaccacaactatttgtttgtgaatcctttgaagaattaaca
gatgcgcttgaaacattttctaaaacaatggcctttaaaacaggtggaaaagaaggttta
gaaaaagcaattcgctctgagaactatgcaacagctgagctaaatagtggattacaaatt
acaggtacatttagcgagacaattgaaaacgatgcaggtgaattaatttacatgcgaaca
aattcgccaacggcattagcgcttcataataaacagttagcaaatcattctaattctgta
cacagtgacggatttggaacaccgattggattactcactgaaaatattgcattagaaaat
tgtacagacgaacaactacaatcattaggaattacaattggaactatcgctgagtttact
tttgcaagtggtattcatgtaaaaggaacagtaacagatattgtaaaaaacgataagaaa
attgctcttatttcctttatcgattgcacagttacttataacgcccgcgttttatttgat
gcttcatggggcgcatttgatatggctgttggctcacaaatcacttcagtattcccaggt
gccgcagatgccgcagcatttttcccaatggatgaagaagttcacgaaattcctgctcca
cttgtactgaatgaacttgaacgtatgtatcaaacagttcgagatattcgaagtgagggg
attttacacgacgcgcatatcgatcaattagtagcaattcaagaagtattaaataaattt
tatgcgaaagaatggttgctgcgccttgaagtattagagttacttttagagcataacaaa
gggcatgaaacatcggcagcattactacatcaactttctactttcacaactgacgaagct
gtaacacgccttattaacaatggtcttgcgttacttccagtaaaggatgtgaaaaatgat
gctaagattaactga

DBGET integrated database retrieval system