KEGG   Bacillus thuringiensis Bt407: BTB_c45080Help
Entry
BTB_c45080        CDS       T02277                                 

Gene name
hmuU
Definition
(GenBank) hemin transport system permease protein HmuU
  KO
K02015  iron complex transport system permease protein
Organism
btg  Bacillus thuringiensis Bt407
Pathway
btg02010  ABC transporters
Module
btg_M00240  Iron complex transport system
Brite
KEGG Orthology (KO) [BR:btg00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BTB_c45080 (hmuU)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:btg02000]
    BTB_c45080 (hmuU)
Transporters [BR:btg02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    BTB_c45080 (hmuU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FecCD
Motif
Other DBs
NCBI-ProteinID: AFV20189
Position
complement(4363678..4364706)
Genome map
AA seq 342 aa AA seqDB search
MESSEVVREKEHPFAKKRWIIAVTLVVLTILGLFYGLFAGSLSFSVRDILTGIQDEGSTV
HRIVWDLRIPRVLVGFIVGTCLAASGTLLQGVMRNPLADPGIIGVSSGAGLVAIVIMILF
PQHLAFLPLGAFLGAFITAMVIYALSWQKGAPPSRIVLVGVSINALIGAATSALMLLHSD
KVQSVLPWLAGGIGGVSWAHLNMIIYYAIFAIILAFFGIKHIRVLMLGDEMAKLLGHNVE
KSRFYLIVVSTLLAGIAVSVSGLIGFVGLVVPHMLRLLVGNDYRYLLPLSCLGGGVLLVF
ADAIARSWFDPIELPVGILLSFLGGPFFLYLIHRGGKQRDFR
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtagtgaagtagtaagagaaaaggaacatccttttgcgaaaaaaagatggata
atagcagttactttagttgtattaacaattctaggcctcttttacggacttttcgcagga
agtttatctttttctgtacgagacattctaacaggtatacaagatgaaggttcgacagtt
catcgaattgtatgggatcttcgcataccgagagttctcgttgggtttatagtaggaaca
tgtttagctgcatctggtacactgctgcaaggggttatgagaaaccctcttgcagatcct
ggtattatcggggtttcatctggggcaggccttgtagcaattgtcatcatgattttattc
ccacagcatctagcttttttaccactaggggcgtttttaggagctttcataacagcgatg
gttatttatgctttatcatggcaaaaaggggcaccaccttcaagaatcgtcttagtagga
gtgtcaatcaatgcattaattggtgcagcaacgtcagctttaatgttattacatagtgac
aaagtacaatccgtgttaccgtggctagcgggcggcattggtggtgtaagttgggcacat
ttaaacatgattatttattatgcaatattcgccattatattagctttctttggtattaag
catattcgagtgttaatgcttggagatgaaatggcaaaactattaggacataatgtggaa
aaaagtcggttttatttaatcgtagtaagtacattattagctggaattgcggtaagtgtg
tctggtcttattggatttgtcggtcttgtcgtaccacatatgctacgtttattagttgga
aatgattatagatatttgctacctttatcatgccttggcggcggggtattacttgttttt
gcggatgcaatagctcgaagttggtttgacccaattgaattgcctgttggtattttactg
tccttcttaggtggtcctttcttcttatatttaattcatagaggaggaaaacaacgtgat
ttccgttaa

DBGET integrated database retrieval system