KEGG   Bacillus thuringiensis Bt407: BTB_c45120Help
Entry
BTB_c45120        CDS       T02277                                 

Gene name
mccB
Definition
(GenBank) cystathionine gamma-lyase MccB
  KO
K17217  cystathionine gamma-lyase / homocysteine desulfhydrase [EC:4.4.1.1 4.4.1.2]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
btg00260  Glycine, serine and threonine metabolism
btg00270  Cysteine and methionine metabolism
btg00920  Sulfur metabolism
btg01100  Metabolic pathways
btg01130  Biosynthesis of antibiotics
btg01230  Biosynthesis of amino acids
Module
btg_M00609  Cysteine biosynthesis, methionine => cysteine
Brite
KEGG Orthology (KO) [BR:btg00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BTB_c45120 (mccB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BTB_c45120 (mccB)
   00270 Cysteine and methionine metabolism
    BTB_c45120 (mccB)
Enzymes [BR:btg01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.1  cystathionine gamma-lyase
     BTB_c45120 (mccB)
    4.4.1.2  homocysteine desulfhydrase
     BTB_c45120 (mccB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Met_gamma_lyase Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AFV20193
Position
complement(4369035..4370168)
Genome map
AA seq 377 aa AA seqDB search
MRAKTKLIHGIRIGEPSTGSVNVPIYQTSTYKQEAVGKHQGYEYSRTGNPTRAALEEMIA
VLENGHAGFAFGSGMAAITATIMLFSKGDHVILTDDVYGGTYRVITKVLNRFGIEHTFVD
TTNLEEVVEAIRPNTKAIYVETPTNPLLKITDIKKISTLAKEKDLLTIIDNTFMTPYWQS
PISLGADIVLHSATKYLGGHSDVVAGLVVVNSPQLAEDLHFVQNSTGGILGPQDSFLLLR
GLKTLGIRMEEHETNSRAIAEFLNNHPKVNKVYYPGLESHQNHELATEQANGFGAIISFD
VDSEETLNKVLEKLQYFTLAESLGAVESLISIPSQMTHASIPADRRKELGITDTLIRISV
GIEDGEDLIEDLAQALA
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgagagcaaagacaaagttaattcatggtattcgcataggagaaccttcaactggatct
gtaaacgtaccgatctatcaaacaagtacgtacaaacaagaagcggttggtaagcatcaa
ggatatgaatattcacgtacaggtaacccaacacgtgcagctttagaagaaatgattgct
gtattagaaaatggtcatgctggatttgcattcggttctggaatggctgctattacagcg
acaattatgttgttctcaaaaggtgaccacgttattttaacagatgatgtttatggtgga
acgtatcgtgttattacgaaagtattaaaccgcttcggtattgaacatacatttgtagac
acaacaaacttagaggaagttgtagaagcaattcgtccaaatacgaaagcgatctatgtg
gaaacaccaacgaacccattactaaaaattactgatattaagaaaatatctactcttgct
aaagagaaagatttattaacaattattgataatacattcatgacgccatattggcagtcg
ccgatttctttaggagcagacattgtacttcatagtgcaacgaaatatttaggaggtcat
agtgacgtagttgcaggtctagtagtggtaaatagcccacaactagcagaagaccttcac
tttgtacaaaactcaacaggaggtattcttggaccacaagatagcttcttactacttcgc
ggtttaaaaacattaggaattcgtatggaagaacatgaaacgaattcacgcgctattgct
gaattcttaaataatcatccaaaagtaaataaagtatattacccaggtcttgaatcacat
caaaaccatgaattagcaacagaacaagcaaatggatttggtgctattatttcgtttgat
gtagatagtgaggaaacattaaataaagtacttgagaaactgcaatactttacacttgct
gaaagcttaggagcagtagaaagtttaatttctatcccatctcaaatgacacatgcatca
atcccagcggatcgccgtaaagaattaggaattacagatacattaattcgtatttctgtc
ggtattgaagatggtgaagatttaattgaagatttagcacaagcgctagcgtaa

DBGET integrated database retrieval system