KEGG   Bacillus thuringiensis Bt407: BTB_c45130Help
Entry
BTB_c45130        CDS       T02277                                 

Gene name
mccA
Definition
(GenBank) O-acetylserine dependent cystathionine beta-synthase MccA
  KO
K17216  cystathionine beta-synthase (O-acetyl-L-serine) [EC:2.5.1.134]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
btg00270  Cysteine and methionine metabolism
btg01100  Metabolic pathways
btg01230  Biosynthesis of amino acids
Module
btg_M00609  Cysteine biosynthesis, methionine => cysteine
Brite
KEGG Orthology (KO) [BR:btg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BTB_c45130 (mccA)
Enzymes [BR:btg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.134  cystathionine beta-synthase (O-acetyl-L-serine)
     BTB_c45130 (mccA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFV20194
Position
complement(4370172..4371095)
Genome map
AA seq 307 aa AA seqDB search
MNVYRGVHELIGHTPIVEITRFSLPKGVRLFAKLEFYNPGGSVKDRLGRELIEDALEKGL
VTQGGTIIEPTAGNTGIGLALAALEHDLRVIVCVPEKFSIEKQELMKALGATVVHTPTEQ
GMTGAIAKAKELVNEIPNSYSPSQFANEANPRAYFKTLGPELWDALNGEINIFVAGAGTG
GTFMGTASYLKEKNIDIKTVIVEPEGSILNGGKAGSHETEGIGLEFIPPFLKTSYFDEIH
TISDRNAFLRVKELAQKEGLLVGSSSGAAFHASLLEAEKAAPGTNIVTIFPDSSERYLSK
DIYKGWE
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtatatcgtggagttcatgagttaattggtcatacaccaattgtagaaattact
cgtttttcacttccgaaaggggtccgcttatttgcaaagcttgaattttataacccaggc
ggaagcgttaaggatcgtttaggaagagaattaatcgaagatgcgctagaaaaagggctt
gttacccaaggtggaacaattattgaaccgactgctgggaatactggtattggactggca
cttgcagcattagaacatgatttacgtgttatcgtttgtgtaccagagaaatttagtatt
gaaaaacaagaattaatgaaagcactaggtgcaacggtcgtccatacaccgactgagcaa
ggaatgaccggtgcaattgcaaaagcaaaagaattagtaaatgaaataccgaattcatac
tctccaagtcagtttgcgaatgaagcaaacccgcgtgcttatttcaaaacactaggtcct
gaactttgggatgcactgaatggagagattaacatatttgttgctggagcaggaactggc
ggtacgtttatggggactgcatcttatttgaaagaaaaaaatatagatattaaaacagtt
atcgtagagccagaaggatctattttaaatggtggtaaggctggttcacatgagaccgaa
ggaattggactggaatttatcccgccatttttgaagacatcttattttgatgaaattcat
acgatttctgatcgaaatgcatttttacgagtgaaagaattagcgcaaaaagaaggactt
ctcgttgggagctcttcaggagcagcatttcatgcgagtttacttgaggcagagaaggca
gcaccaggtacaaatattgtaaccatttttcctgatagtagtgagcgctatttaagtaaa
gacatatacaaaggatgggaataa

DBGET integrated database retrieval system