KEGG   Bacillus thuringiensis Bt407: BTB_c45330Help
Entry
BTB_c45330        CDS       T02277                                 

Definition
(GenBank) hypothetical protein
Organism
btg  Bacillus thuringiensis Bt407
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zf-RRPl_C4 RPA_interact_C Zn_Tnp_IS1595 DUF1610
Motif
Other DBs
NCBI-ProteinID: AFV20214
Position
complement(4387560..4387748)
Genome map
AA seq 62 aa AA seqDB search
MFICPNCKGKDIGKIGVNQFYCWNCYIELSVSKGKIHTHQVEEDGSLSSLDDLFDENERT
IG
NT seq 189 nt NT seq  +upstreamnt  +downstreamnt
atgttcatttgtccaaattgcaaagggaaagacattggaaaaataggtgtcaaccaattt
tattgctggaattgttatatcgaattatcggtttcaaaggggaaaatccatacgcatcaa
gttgaggaagatggttcattaagctctcttgatgatttatttgatgagaatgaaagaacg
atcggataa

DBGET integrated database retrieval system