KEGG   Bacillus thuringiensis Bt407: BTB_c45340Help
Entry
BTB_c45340        CDS       T02277                                 

Definition
(GenBank) helicase, RecD/TraA
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
btg03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:btg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BTB_c45340
Enzymes [BR:btg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BTB_c45340
DNA repair and recombination proteins [BR:btg03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BTB_c45340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 Viral_helicase1 AAA_11 UvrD-helicase AAA_12 UvrD_C T2SSE AAA AAA_22 NTPase_1 AAA_16 AAA_29 Zeta_toxin AAA_28 AAA_18 TsaE GNAT_acetyltr_2 DEAD DUF4926
Motif
Other DBs
NCBI-ProteinID: AFV20215
Position
complement(4387876..4390212)
Genome map
AA seq 778 aa AA seqDB search
MGNQHAMDLFEEEKKFIKAQVLHTIFHNEENLYSVVSMKVIETNETYDEKKVMINGHFPR
MHEDEVFTLTGHFKDHPKYGKQYMVETFKKELPQTKAGMVQYLASDLFKGIGKRTAEKIV
DHLGEHAISKIMDDPEALNGVVNKQKAQEIYETIVEHQGLEKVMSFLNGYGFGTKLSIKI
YQQYKEMTLEVIRNNPYQLIEEVDGIGFGRADDIGRALGISGNHDDRVRAGCFYTLENVS
LQLGHVYMRKDQLVRETMSLLNNQEGRVTEEDIIGCIETMQSEGKVIIEEERVYLATLFY
SEKGVVKSIRRLMNQEETPSFPEAEVLKTLGEIEEQLNVQYAPFQQEAIQTALHKPMMLL
TGGPGTGKTTVIKGIVEMYASLHGLSLNPNEYSDDNPFPILLTAPTGRAAKRMSESTGLP
ACTIHRLLGWTPEGSFQRNETDPVQGKLLIIDEFSMVDIWLANQLFKSLPTNIQVIVVGD
EDQLPSVGPGQVLKDLLNAGAVPTVKLTEIYRQAEGSSVIQLAHAIKDGTLPPDLAQNKK
DRSFISCTGAQIVEVVKKVCENAKTKGFSARDVQVLAPMYRGPAGINVLNEALQQVFNPK
REKSKEIQYGDVVYRRGDKVLQLVNQPESQVFNGDIGEIVSVFYAKENVEQQDMIIVSFD
GIEVTYTKPDLNQITHAYCCSIHKSQGSEFPIVIMPIVKSYNRMLRRNLIYTGITRSKKF
LIICGEEVAFQSGVNRLDDAMRQTTLASRLQESQGEVQMVTVNGEEMDVENISPYDFM
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatcaacatgcaatggatttgtttgaggaagagaaaaaatttataaaagcgcaa
gttcttcataccattttccacaacgaagaaaacctctattccgttgtcagtatgaaagtc
attgaaacgaatgaaacgtatgacgaaaagaaagtaatgataaacggtcattttccccgc
atgcatgaagatgaagtgtttacattgacaggtcactttaaggaccatccaaagtatgga
aaacaatatatggttgaaacatttaaaaaagaattgccgcaaacaaaagcaggtatggtg
caatatttagcgagtgatttatttaaagggataggaaagcgtacagcggaaaaaattgtg
gatcatctcggggaacatgctatttctaaaattatggatgaccctgaggcgttaaatggt
gttgttaacaaacaaaaggctcaggaaatatatgagacaattgttgaacatcaaggatta
gaaaaagtaatgagctttttaaatggttacggttttggaacgaaactttctattaagatt
taccagcaatataaagagatgacattagaagtgattcgtaataatccgtatcaacttatt
gaagaagtggacgggattggttttggacgagcggatgatatagggcgtgcgttagggata
tcgggtaatcacgacgaccgtgtacgagcgggatgtttttacacattagagaatgtctca
ttgcaacttggtcacgtttatatgaggaaagatcaacttgtaagagaaacgatgtcactt
ttaaacaatcaagaaggaagagtgactgaagaagatattataggttgtattgaaacgatg
caaagtgaagggaaagttatcatagaagaagaacgagtgtatttagcaactttattctac
tctgaaaaaggtgttgtaaagtctattcgtcgattgatgaatcaagaggaaacaccttca
tttcctgaagcagaagtgttaaaaacattaggtgaaattgaagaacagttgaatgtacaa
tatgcaccgtttcagcaagaagcgattcaaacggcacttcataaaccgatgatgttatta
acaggtggaccaggaacaggaaaaacaaccgttattaaagggattgttgaaatgtatgcg
tcacttcacggattatcgttaaatccgaatgaatacagtgatgataatccatttccaata
ctattaacagctccaacaggaagagcagcgaagcggatgagtgaatcgacaggacttcca
gcttgcacaattcaccgtttgcttggctggacgccagaaggatctttccagcgtaatgaa
acggatcctgtccaaggtaagctccttattatcgatgaattttcaatggttgatatttgg
ctcgcaaatcagctatttaagtcgctaccaacgaatattcaagttatcgttgtaggtgat
gaagatcagttgccatctgtaggacctggacaagtattaaaagatttattaaatgcaggt
gcagttccgacagtgaagcttactgaaatttatcgtcaagcagaaggctcatctgttatt
caacttgcccatgcgatcaaagacggcacactcccgccagatttagcgcaaaataaaaaa
gatcgttcgtttatcagctgtacaggggctcaaattgttgaggttgtgaaaaaagtttgc
gaaaacgctaaaacaaaaggctttagtgcaagggatgttcaagtattagcaccgatgtac
cgcgggcctgctggtattaatgtattaaacgaagcgctgcaacaagtatttaacccgaaa
agggaaaagagtaaagaaatccagtacggtgatgttgtataccgaagaggcgataaagta
ctgcaactcgttaatcagccggagagccaagtgtttaatggggatatcggagaaattgtt
tcggtgttttatgcgaaagaaaacgttgagcaacaagatatgattatcgtttcatttgat
ggaattgaggtaacgtatacaaagccggatttaaatcaaattacacatgcatattgttgt
tcgattcataaatcacaaggtagtgaatttccgattgttattatgccgattgtgaaaagt
tacaaccgtatgttacgccgtaatttaatttacacgggcattacaagaagtaagaagttc
cttattatttgcggggaggaagtagctttccaatctggtgtaaatcgccttgatgatgca
atgcgtcaaacaactttagctagtcgcttgcaggaatcacaaggagaagtacagatggtc
acagttaatggcgaggaaatggacgtggaaaacatttcaccgtatgatttcatgtaa

DBGET integrated database retrieval system