KEGG   Bacillus thuringiensis Bt407: BTB_c45360Help
Entry
BTB_c45360        CDS       T02277                                 

Gene name
mnmA
Definition
(GenBank) tRNA-specific 2-thiouridylase MnmA
  KO
K00566  tRNA-uridine 2-sulfurtransferase [EC:2.8.1.13]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
btg04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:btg00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    BTB_c45360 (mnmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:btg03016]
    BTB_c45360 (mnmA)
Enzymes [BR:btg01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.13  tRNA-uridine 2-sulfurtransferase
     BTB_c45360 (mnmA)
Transfer RNA biogenesis [BR:btg03016]
 Prokaryotic Type
  tRNA modification factors
   Thiolation factors
    BTB_c45360 (mnmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_Me_trans NAD_synthase QueC ThiI ATP_bind_3 FlaG Asn_synthase
Motif
Other DBs
NCBI-ProteinID: AFV20217
Position
complement(4391077..4392192)
Genome map
AA seq 371 aa AA seqDB search
MNKLPHETRVVIGMSGGVDSSVAALLLKEQGYDVIGIFMKNWDDTDENGVCTATEDYNDV
IEVCNQIGIPYYAVNFEKQYWDKVFTYFLDEYRAGRTPNPDVMCNKEIKFKAFLEHAIAL
GADYVATGHYARVAYMDGEYKMLRGVDDNKDQTYFLNQLSQEQLSKTMFPLGELKKPQIR
EMAKEAGLATAAKKDSTGICFIGERNFKDFLSNYLPAQPGVMQTLSGEVKGKHDGLMYYT
IGQRHGLGIGGNGDPWFAVGKNLKENILYVDQGFHNELLYGDEVIATNVGWVSNKEKETE
FKCTAKFRYRQEDNKVTVQIVDENTVRILCDEPIRAITPGQAVVFYDGDECLGGATIDEV
YRSGKKLDYLG
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaactacctcacgaaacacgcgttgtcatcggaatgtccggtggcgtcgattca
tctgtagcagcacttttattaaaagagcaaggttatgatgtaatcggaatttttatgaaa
aactgggatgatacagatgagaatggtgtctgcacagcaacagaagattacaatgatgta
attgaagtgtgtaaccaaattggtattccgtattatgcagtaaactttgaaaaacaatac
tgggataaagtatttacgtacttcttagatgagtaccgagctggtcgtacaccaaaccca
gatgtaatgtgtaataaagaaattaaatttaaagcatttttagagcatgcaattgcgctt
ggtgccgattatgtagcaacaggtcattatgcacgcgttgcttatatggacggcgaatat
aaaatgcttcgcggcgttgatgacaataaagatcaaacatacttcttaaatcaattaagc
caagagcaattatcaaaaacaatgttcccgttaggtgaactgaagaaaccacaaattcgt
gaaatggcgaaagaagctggcttagcgacagcggcgaaaaaagatagtacaggtatttgc
ttcattggtgagcgtaactttaaagatttcttaagtaactacttaccagcacaaccaggt
gtaatgcaaacattatctggtgaagtgaaagggaagcatgacggtttaatgtattataca
attggacaacgtcatggtcttggaattggtggtaatggtgatccatggtttgctgttgga
aaaaatctaaaagaaaacattttatatgttgatcaaggattccataacgaacttctatat
ggtgatgaagttattgctacgaatgtaggatgggtaagtaacaaagaaaaagaaacagaa
tttaagtgcacggcgaaattccgttatcgtcaagaagacaataaagtaacggttcaaatc
gttgatgaaaatacggttcgtattctttgtgatgagccaattcgtgcaattacaccagga
caagcagtcgttttctatgatggagatgagtgcttaggcggtgctacaattgatgaagta
taccgtagtggtaagaaattggattatttaggataa

DBGET integrated database retrieval system