KEGG   Bacillus thuringiensis Bt407: BTB_c45390Help
Entry
BTB_c45390        CDS       T02277                                 

Gene name
yrvN
Definition
(GenBank) putative AAA domain-containing protein YrvN
  KO
K07478  putative ATPase
Organism
btg  Bacillus thuringiensis Bt407
Brite
KEGG Orthology (KO) [BR:btg00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    BTB_c45390 (yrvN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MgsA_C AAA_assoc_2 AAA RuvB_N AAA_16 AAA_5 Sigma54_activat TIP49 Mg_chelatase IstB_IS21 AAA_22 AAA_19 Sigma54_activ_2 ResIII AAA_14 DNA_pol3_delta2 AAA_18 Parvo_NS1 AAA_24 ABC_tran AAA_25 AAA_30 IPT NB-ARC AAA_28 AAA_11 RNA_helicase
Motif
Other DBs
NCBI-ProteinID: AFV20220
Position
4394100..4395386
Genome map
AA seq 428 aa AA seqDB search
MKQPLAHRMRPTNIQEIIGQQHLVGEGKILWRMVQANHFQSMILYGPPGTGKTSIASAIA
GSTGTPFRLLNAVTHNKKDMEVVVQEAKMHRHLVLILDEVHRLDKAKQDFLLPHLESGLL
TLIGATTSNPFHAINSAIRSRCQIFELHALTEDDILIGLKRALEDKEKGLGEYAVTVTDE
ALHHFANASGGDMRSAYNALELAVLSSFTTDDQAAEITLEIAEECLQKKSFVHDKGGDAH
YDVLSAFQKSVRGSDVNAALHYLARLIEAGDLQSIGRRLLIMAYEDIGLASPQAGPRTLA
AIESAERVGFPEARIPLANAVIELCLSPKSNSAYKALDAALHDLRNGQTGDIPSHLKDSH
YKGAESLGRGIGYLYPHDHPNGWVRQQYLPDKIKNKQYYKPKTTGKFEQALSTVYERLQT
SNKTKNKG
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaccactcgcacatcgaatgcgccctacaaatattcaagaaattattgggcaa
caacatttagttggtgaaggaaagattttatggcgaatggtccaagcaaatcattttcaa
tctatgattttatacggtcctccaggtacaggaaaaacatccattgccagtgcaattgca
ggaagtaccggtaccccgtttcgtctattaaacgctgttactcacaataaaaaagatatg
gaagttgtcgtacaagaagcaaagatgcatcgacacctcgttttaattttagatgaagtt
caccgtctagataaagcaaagcaagactttctattacctcacttagaaagcggacttctt
actttaattggtgcaacgacaagtaatccattccatgcaataaactccgctattcgaagc
aggtgtcaaattttcgaattacacgcactaacagaagatgatattttaattgggttaaaa
agagctttagaagataaagaaaaaggccttggagaatatgctgtaacggtaacagatgaa
gcactacatcattttgcaaatgcctctggtggtgatatgcgttccgcttataacgcactt
gaacttgctgtattatctagctttactacagacgatcaagcggctgaaatcacactcgag
attgcagaagaatgcttacaaaagaagagcttcgttcacgacaaaggcggcgatgctcat
tatgacgtattatcagcatttcaaaaatcagtacgcggaagtgatgtaaatgcagcgctc
cattatttagcacgccttattgaagcaggtgatttacaaagtattggcagacgccttctt
attatggcttatgaagatattggacttgctagcccacaagctggaccgcgtacactagct
gcaattgaatcagctgaacgagttggattcccagaagcacgcatcccacttgcaaatgcc
gttatagagctatgcttatcaccaaaatcaaattcagcttataaagcacttgatgctgca
ttacacgatttacgcaacggtcaaacaggtgacattccaagccatttaaaagatagtcat
tacaaaggcgcagaatcactcggaagaggcattggatatttatatccacacgaccatcca
aatggctgggtaaggcaacaatacttacctgataaaataaaaaacaagcaatattataaa
ccgaaaacgacagggaaatttgagcaagcactttctactgtttatgaaagattacaaact
tcgaataaaacgaaaaataaagggtaa

DBGET integrated database retrieval system