KEGG   Bacillus thuringiensis Bt407: BTB_c45410Help
Entry
BTB_c45410        CDS       T02277                                 

Definition
(GenBank) molybdopterin biosynthesis MoeB
  KO
K22132  tRNA threonylcarbamoyladenosine dehydratase
Organism
btg  Bacillus thuringiensis Bt407
Brite
Transfer RNA biogenesis [BR:btg03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    BTB_c45410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ThiF Sacchrp_dh_NADP 2-Hacid_dh_C UDPG_MGDP_dh_N DUF3811 ApbA
Motif
Other DBs
NCBI-ProteinID: AFV20222
Position
complement(4396681..4397448)
Genome map
AA seq 255 aa AA seqDB search
MLHQFSRNELAFGKEGLEILKNSTVGILGIGGVGSFSAEALARSGVGRLVLVDKDVVDIT
NVNRQIHALVSTVGRSKVELMKERIADINPECEVIGLEMFYTDETYEEFFKHGLDFVVDA
SDTITFKIHLIKQCLRRKIKIISCMGAANKMDPTRFRIADISKTHTDPIAKVIRTKLRKE
GIKKGVKVVFSDENPIVIREEVRKEIVPDENAKIRKAKLPPSSNAFVPSVAGLIMASHVV
RERIKNVEVKRVGQE
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgttacatcaattttcacgtaatgaattagccttcggtaaagaaggacttgaaatatta
aaaaatagtacagtcggtattttaggaattggcggcgtaggttcattttcagctgaagcg
ttagcgcgttctggagtaggacgtctcgtattagttgataaagacgttgtagatattaca
aacgtaaaccgtcaaattcacgctttagtatctactgtaggacgttcaaaagtagaatta
atgaaagagcgtattgcagacattaatccggaatgtgaagtaattggattagaaatgttt
tatacagatgaaacatatgaagagttctttaaacacggtttagatttcgtagtggatgca
tctgatacgattacgttcaaaatccatttaattaaacaatgtttacgtcgtaaaattaaa
attatctcatgtatgggtgcagcaaataaaatggacccaactcgtttccgtattgcggac
atttctaaaacacatacagatccaattgcgaaagtaattcgtacgaagcttcgtaaagag
ggtattaaaaaaggtgtaaaagttgtcttctctgacgaaaacccaatcgtaattcgtgaa
gaagtacgtaaagaaatcgtaccagacgagaatgcaaaaattcgtaaagcgaaattaccg
ccttcatcaaatgcattcgtaccatctgtggcaggcttaattatggcaagtcacgttgta
cgtgaacgtattaaaaatgtagaagtgaaacgtgtagggcaagaataa

DBGET integrated database retrieval system