KEGG   Bacillus thuringiensis Bt407: BTB_c45420Help
Entry
BTB_c45420        CDS       T02277                                 

Gene name
aspS2
Definition
(GenBank) aspartate--tRNA ligase AspS
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
btg00970  Aminoacyl-tRNA biosynthesis
Module
btg_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:btg00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BTB_c45420 (aspS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:btg01007]
    BTB_c45420 (aspS2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:btg03016]
    BTB_c45420 (aspS2)
   03029 Mitochondrial biogenesis [BR:btg03029]
    BTB_c45420 (aspS2)
Enzymes [BR:btg01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     BTB_c45420 (aspS2)
Amino acid related enzymes [BR:btg01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   BTB_c45420 (aspS2)
Transfer RNA biogenesis [BR:btg03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BTB_c45420 (aspS2)
 Prokaryotic Type
   Other AARSs
    BTB_c45420 (aspS2)
Mitochondrial biogenesis [BR:btg03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BTB_c45420 (aspS2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 GAD tRNA_anti-codon tRNA-synt_2d tRNA-synt_2b HD_3
Motif
Other DBs
NCBI-ProteinID: AFV20223
Position
complement(4397651..4399426)
Genome map
AA seq 591 aa AA seqDB search
MAERTHACGKVTVEAVGQTVQLKGWVQKRRDLGGLIFIDLRDRTGIVQVVFNPETSKEAL
EVAETIRSEYVLHIEGTVVERGEGAINDNMATGRIEVQATKVNVLNAAKTTPIIIADDTD
ASEDVRLKYRYLDLRRPVMFNTFKMRHDVTKTIRNFLDTEEFLEVETPILTKSTPEGARD
YLVPSRVHDGEFYALPQSPQLFKQLLMVGGFERYYQVARCFRDEDLRADRQPEFTQIDIE
ASFLTQDEILEMMERMMTKVMKDAKGVEVSAPFPRMKYADAMARYGSDKPDTRFEMELTD
LSEFAAGCGFKVFTSAVESGGQVKAINAKGAASKYSRKDIDALTEFVKVYGAKGLAWLKV
EEDGLKGPIAKFFGEEDANVLMSTLEATAGDLLLFVADKKSVVADSLGALRLRLGKELEL
IDESKFNFLWVTDWPLLEYDEDADRYFAAHHPFTMPFREDVELLETAPEKARAQAYDLVL
NGYELGGGSLRIYERDVQEKMFKALGFSQEEAQEQFGFLLEAFEYGTPPHGGIALGLDRL
VMLLAGRTNLRDTIAFPKTASASCLLTEAPSPVAEAQLEELNLKLSLKEEK
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaaagaacacatgcatgtggaaaagtaacagtagaagctgttggacaaacagtt
caattaaaaggttgggtacaaaaacgccgtgacttaggtggattaatctttatcgattta
cgtgaccgtacaggtatcgtacaagttgtatttaacccagaaacatcaaaagaagcgtta
gaagtagcagaaacaattcgtagcgaatacgtattacacatagaaggtacagttgttgaa
cgtggtgaaggcgcaattaatgacaatatggcaactggtcgtattgaagtacaagcaaca
aaagtaaatgtactaaatgcagcgaaaacaacaccaattatcattgctgatgatacagat
gcatcagaagatgtgcgtttaaaatatcgttatttagacttacgtcgtcctgtaatgttc
aacacattcaaaatgcgtcacgacgtaacaaaaacaattcgtaacttcttagatacagaa
gagttcttagaagtagaaacaccaattttaacgaagagtacgccagaaggagctcgtgac
tatttagtaccaagtcgtgtacatgacggtgaattctatgcattaccacagtcaccacag
ttatttaaacagcttcttatggtcggcggatttgagcgttactatcaagtagcacgttgt
ttccgtgatgaagatttacgtgcagatcgtcaaccggaattcacgcaaatcgatatcgaa
gcttcattcttaacacaagatgaaattttagaaatgatggagcgtatgatgacgaaagtt
atgaaggatgcaaaaggtgtagaagttagtgcaccattccctcgtatgaaatatgctgat
gcaatggctcgctacggttctgataagccagatacacgctttgaaatggaactaacagac
ttatctgagtttgcagcaggttgtggctttaaagtgtttacaagtgctgtagaaagcggc
ggacaagtaaaagcaatcaatgcaaaaggtgctgcaagtaaatattctcgtaaagacatc
gatgcattaactgaattcgtgaaagtatacggtgcaaaaggtctagcttggcttaaagtt
gaagaagacggcctaaaaggaccgattgcgaaattcttcggtgaagaagatgcaaatgtg
ttaatgagcacattagaagctactgctggcgacttattactattcgtagcagataagaag
agcgttgttgcagatagcttaggcgcacttcgtttacgtctaggtaaagagcttgagtta
attgacgaaagtaaatttaacttcctatgggtaacggattggccacttcttgagtacgat
gaagatgcagatcgttatttcgcagctcaccatccattcacaatgccattccgtgaagac
gttgagctactagaaacagcaccagaaaaagcacgtgcacaagcatatgaccttgtatta
aacggttatgagcttggtggtggatcacttcgtatttatgagcgtgacgtacaagaaaaa
atgttcaaagcacttggattctcacaagaagaagcgcaagagcaattcggattcttatta
gaagcattcgaatacggtacaccaccacacggcggaatcgcattaggtttagatcgtctt
gttatgttacttgcaggccgtacgaaccttcgtgatacaattgcattcccaaaaacagca
agcgcaagctgcttattaacagaagctccaagcccagttgcagaagcacagcttgaagag
ttaaacttaaaattaagcttaaaagaagagaagtaa

DBGET integrated database retrieval system