KEGG   Bacillus thuringiensis Bt407: BTB_c45430Help
Entry
BTB_c45430        CDS       T02277                                 

Gene name
hisS2
Definition
(GenBank) histidine--tRNA ligase 2
  KO
K01892  histidyl-tRNA synthetase [EC:6.1.1.21]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
btg00970  Aminoacyl-tRNA biosynthesis
Module
btg_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:btg00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    BTB_c45430 (hisS2)
Enzymes [BR:btg01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.21  histidine---tRNA ligase
     BTB_c45430 (hisS2)
Amino acid related enzymes [BR:btg01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   BTB_c45430 (hisS2)
Transfer RNA biogenesis [BR:btg03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BTB_c45430 (hisS2)
 Prokaryotic Type
    BTB_c45430 (hisS2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_His HGTP_anticodon tRNA-synt_2b tRNA-synt_2d PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AFV20224
Position
complement(4399439..4400710)
Genome map
AA seq 423 aa AA seqDB search
MSIQIPRGTQDILPGTVELWQYIEGQAREICRRYNYKEIRTPIFEHTELFLRGVGDTTDI
VQKEMYSFQDRGERSLTLRPEGTAPVVRSYVENKMFGDATQPTKLYYIGQMFRYERPQAG
RYRQFVQFGIEAIGSNDPAIDAEVIALAVEFYRGMGLKNIKVVLNSLGDAASRQAHRDAL
IAHFEPRIGEFCSDCQSRLEKNPLRILDCKKDRNHELMATAPSITEYLNEDSAVYYDKVQ
ELLTMMDVPFEKDPNLVRGLDYYQHTVFEIMSEAEGFGAITTLSGGGRYNGLVQEIGGPE
MPGIGFAMSIERLIMALKAENIELPLEHSIDCYVVALGEKAKDHAAKVAFDLRKAGLSVE
KDYLDRKMKAQFKSADRLKAKFVAVLGEDELDKGIINLKDMATGEQEEVALDVFASYVAE
KLI
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgtctattcaaatcccacgcggaacgcaagatattcttccaggcactgttgagttatgg
cagtatatcgaagggcaagcacgcgaaatttgccgtcgttacaattataaagaaattcgt
acaccaatttttgagcacactgagctatttttacgcggtgttggtgatacgacagatatc
gtacaaaaagaaatgtactcattccaagatcgtggagagcgtagcttaacactacgtcca
gaaggtactgcacctgttgtacgttcttacgttgaaaataaaatgtttggtgatgcaaca
caaccaacgaaattatactatatcggtcaaatgttccgttatgaaagaccacaagcaggt
cgctatcgtcaattcgtacaattcggtatcgaagcaatcggcagtaatgaccctgcaatt
gatgcagaagtaattgcacttgctgttgaattttaccgcggcatgggcttaaaaaatatt
aaagttgtattaaacagtttaggtgacgcagcgagtcgtcaagcacaccgtgatgcatta
atcgcacactttgagccacgtatcggcgaattctgctctgactgtcaatctcgcttagaa
aagaacccacttcgaattttagactgtaagaaggaccgtaaccatgaattaatggcaaca
gctccatctattacagaatacttaaacgaagattcagcagtatactacgacaaagtacaa
gaactattaacgatgatggatgttccatttgaaaaagatccgaacttagtgcgtggttta
gactactatcaacatactgtttttgaaattatgagtgaggcagaaggtttcggtgcgatc
actacattaagcggtggtggccgttataacggacttgtacaagaaatcggtggaccagaa
atgccaggtatcggttttgcaatgagtattgaacgtttaattatggcgctaaaagctgaa
aacattgaattaccacttgaacatagcattgattgttacgttgtagcgcttggtgaaaaa
gcgaaagaccatgctgcaaaagtggcattcgatcttcgtaaagctggattgtcggttgaa
aaagattatttagatcgcaaaatgaaagcacaatttaaatcagcagatcgtctaaaggcg
aaatttgtagctgtattaggagaagatgagctagataaaggcatcattaacttgaaagat
atggcaacaggtgaacaagaagaagtagctttagatgtatttgcttcatacgtagcagag
aaattaatatag

DBGET integrated database retrieval system