KEGG   Bacillus thuringiensis Bt407: BTB_c45990Help
Entry
BTB_c45990        CDS       T02277                                 

Gene name
hemB
Definition
(GenBank) delta-aminolevulinic acid dehydratase HemB
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
btg00860  Porphyrin and chlorophyll metabolism
btg01100  Metabolic pathways
btg01110  Biosynthesis of secondary metabolites
btg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:btg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BTB_c45990 (hemB)
Enzymes [BR:btg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     BTB_c45990 (hemB)
Exosome [BR:btg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BTB_c45990 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: AFV20280
Position
complement(4458786..4459775)
Genome map
AA seq 329 aa AA seqDB search
MNSLQFNRHRRLRQSGGMRALVRETFLHTEDFIYPIFVLEGENVRNEVPSMPGVYQMSLD
LLQAEMQEVVDLGIRSVIVFGLPAEKDEVGSSAYCDHGIVQRAIQQIKGDFPELVVVADT
CLCQFTSHGHCGVIEDGIILNDESLAVLAKTAVSQAKAGADIIAPSNMMDGFVTAIRHAL
DENGFGHVPVMSYAVKYSSAFYGPFRDAAHGAPQFGDRKTYQMDPANRMEAFREAESDVM
EGADFLIVKPALSYLDIVRDVKNNFNLPVVAYNVSGEYSMIKAAAQNGWINEKEVVLEKL
ISMKRAGADLIITYHAKDAAKWLQEGGAK
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaactctttacaatttaatcgtcatcgtcgtttaagacaaagcgggggcatgcgtgcg
cttgtgcgtgaaacgtttttacatacggaagattttatttaccctatttttgtattagaa
ggtgaaaatgttcgtaatgaagttccttctatgccaggcgtatatcaaatgtctttagat
ttattgcaagctgaaatgcaagaagttgttgatttaggtattcgttctgttattgtattt
ggtttacctgctgaaaaggatgaagttggatcatcagcatattgtgatcatggaattgta
caacgtgctattcagcaaattaaaggtgatttccctgagctagtagtagttgcagacaca
tgtttatgtcaatttacaagccatggtcattgcggtgtaattgaagatggtattatttta
aatgacgagtctcttgcagttcttgcgaaaacagctgtaagtcaagcgaaagcaggagcg
gacattattgcgccatcaaacatgatggacggcttcgtaacagcaattcgccatgcatta
gacgaaaatggttttggacacgtgccagttatgtcgtacgctgtgaaatattcatcagca
ttttatggaccattccgtgatgctgcgcacggtgcaccgcaatttggtgaccgtaaaaca
tatcaaatggatccggcaaaccgtatggaagcattccgtgaagcagaatcagatgtaatg
gaaggtgcagatttcttaatcgtaaaaccagctctttcttacttagatatcgttcgtgat
gtgaaaaataactttaatttaccagttgtcgcttataatgtaagtggtgaatattcgatg
attaaagcggcagcgcaaaatggctggattaatgaaaaagaagttgttcttgaaaaatta
attagtatgaaacgtgcaggagcagacttaattattacgtatcatgcgaaagatgcagca
aaatggttacaagaaggaggcgctaaataa

DBGET integrated database retrieval system