KEGG   Bacillus thuringiensis Bt407: BTB_c47510Help
Entry
BTB_c47510        CDS       T02277                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase PfkA
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
btg00010  Glycolysis / Gluconeogenesis
btg00030  Pentose phosphate pathway
btg00051  Fructose and mannose metabolism
btg00052  Galactose metabolism
btg00680  Methane metabolism
btg01100  Metabolic pathways
btg01110  Biosynthesis of secondary metabolites
btg01120  Microbial metabolism in diverse environments
btg01130  Biosynthesis of antibiotics
btg01200  Carbon metabolism
btg01230  Biosynthesis of amino acids
btg03018  RNA degradation
Module
btg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:btg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTB_c47510 (pfkA)
   00030 Pentose phosphate pathway
    BTB_c47510 (pfkA)
   00051 Fructose and mannose metabolism
    BTB_c47510 (pfkA)
   00052 Galactose metabolism
    BTB_c47510 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    BTB_c47510 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BTB_c47510 (pfkA)
Enzymes [BR:btg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BTB_c47510 (pfkA)
Protein phosphatases and associated proteins [BR:btg01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BTB_c47510 (pfkA)
Messenger RNA biogenesis [BR:btg03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BTB_c47510 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Peripla_BP_1 NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AFV20430
Position
complement(4601660..4602619)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRAVVRKAIFHDIEVYGIYHGYAGLISGHIEKLELGSVGDI
IHRGGTKLYTARCPEFKDPEVRLKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEQGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWA
GLADGAETILIPEEEYDMDDVIARLKRGSERGKKHSIIVVAEGVGSAIDIGKHIEEATNF
DTRVTVLGHVQRGGSPSAQDRVLASRLGARAVELLIAGRGGRCVGIQDNKLVDHDIIEAL
AQKHTIDKDMYQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattggtgtattaacaagtggtggagattcacctggtatgaatgctgccatt
cgtgcagttgttcgtaaagcgattttccatgatattgaagtatatggtatttaccatgga
tacgctggattaatttctggtcacattgaaaaattagaacttggttctgttggcgatatt
atccaccgcggtggtacgaaattatatacagcaagatgtcctgagtttaaagacccagaa
gtacgactaaaaggtatcgagcaattaaagaaacatggtatcgaaggacttgttgttatt
ggtggagatggttcttaccaaggcgctaaaaaattaactgaacaaggattcccatgtgtt
ggtgtaccaggtacaatcgacaatgatatccctggaacagacttcacaattggtttcgat
acagctttaaacactgttattgatgcaattgataaaatccgtgacacagctacatctcat
gaacgtacatatgttatcgaagtaatgggacgtcacgctggtgatatcgcattatgggct
ggtttagctgatggtgcagaaacaatcttaattccagaagaagagtatgacatggatgat
gttatcgctcgtctgaagcgcggtagtgaacgtggtaaaaaacacagtattattgttgta
gctgaaggtgttggaagtgcaattgacatcggtaagcacattgaagaagcaacaaacttt
gatactcgtgtaactgtattaggtcacgtacaacgtggcggatcaccaagtgcacaagac
cgtgtattagcaagtcgtcttggcgcaagagcagttgaattattaattgctggtagaggt
ggacgttgtgtaggtattcaagataacaaacttgttgatcatgatattatcgaagcgtta
gctcaaaagcatacaatcgataaagatatgtatcaattatctaaagaattatccatctaa

DBGET integrated database retrieval system