KEGG   Bacillus thuringiensis Bt407: BTB_c55460Help
Entry
BTB_c55460        CDS       T02277                                 

Gene name
mmgA
Definition
(GenBank) acetyl-CoA acetyltransferase MmgA
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
btg00071  Fatty acid degradation
btg00072  Synthesis and degradation of ketone bodies
btg00280  Valine, leucine and isoleucine degradation
btg00310  Lysine degradation
btg00362  Benzoate degradation
btg00380  Tryptophan metabolism
btg00620  Pyruvate metabolism
btg00630  Glyoxylate and dicarboxylate metabolism
btg00640  Propanoate metabolism
btg00650  Butanoate metabolism
btg00900  Terpenoid backbone biosynthesis
btg01100  Metabolic pathways
btg01110  Biosynthesis of secondary metabolites
btg01120  Microbial metabolism in diverse environments
btg01130  Biosynthesis of antibiotics
btg01200  Carbon metabolism
btg01212  Fatty acid metabolism
btg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:btg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BTB_c55460 (mmgA)
   00630 Glyoxylate and dicarboxylate metabolism
    BTB_c55460 (mmgA)
   00640 Propanoate metabolism
    BTB_c55460 (mmgA)
   00650 Butanoate metabolism
    BTB_c55460 (mmgA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BTB_c55460 (mmgA)
   00072 Synthesis and degradation of ketone bodies
    BTB_c55460 (mmgA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BTB_c55460 (mmgA)
   00310 Lysine degradation
    BTB_c55460 (mmgA)
   00380 Tryptophan metabolism
    BTB_c55460 (mmgA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BTB_c55460 (mmgA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BTB_c55460 (mmgA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BTB_c55460 (mmgA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:btg04147]
    BTB_c55460 (mmgA)
Enzymes [BR:btg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BTB_c55460 (mmgA)
Exosome [BR:btg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BTB_c55460 (mmgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AFV21196
Position
complement(5339522..5340805)
Genome map
AA seq 427 aa AA seqDB search
MYTTLERGAMIAPLLNVGIPSERSVLKNEMGERNMSKTVILSAARTPVGKFGGSLKDVKA
TELGGIAIKAALERANVAASDVEEVIFGTVIQGGQGQIPSRQAARAAGIPWEVQTETVNK
VCASGLRAVTLADQIIRTGDQSLIVAGGMESMSNTPYILRGARWGYRMGNNEVIDLNVAD
GLTCAFSGTHMGVYGGEVAKEDGISREAQDEWAYRSHQRAVSAHKEGRFEEEIVPVTIPQ
RKGDPIVVAKDEAPREDTTIEKLAKLKPVFDKEAAVTAGNAPGLNDGGAALVLMSEDRAK
QEGRKPLATILAHTAIAVESKDFPRTPGYAINALLEKTGKTIEDIDLFEINEAFAAVAIA
STEIAGIDPEKLNVNGGAVAMGHPIGASGARIIVTLIHALKQRGGGIGIASICSGGGQGD
AVMIEVH
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgtatacaactttagaaagaggtgcaatgattgcacctcttctcaacgtagggataccg
agcgagcgctcagtgttaaaaaatgaaatgggggaaagaaacatgagtaaaacagttatt
ttaagtgctgcaagaacaccagttggaaaatttggaggatctttaaaagatgtaaaagcg
acggaacttggaggaattgcaattaaagcagcgcttgaaagagcaaatgttgcggctagt
gatgttgaagaagttatatttggaacggttattcaggggggacaggggcaaattccatcg
cgtcaagctgcaagggctgctggaatcccttgggaagtgcagacggaaacagtgaataaa
gtttgtgcatcaggacttcgtgcggttacgttagcggatcaaattattcgtactggcgat
caatcactgattgtagctggcggtatggagtcgatgagtaatactccttacattttacgc
ggagcaagatggggatacagaatgggcaacaatgaagttattgatttaaacgttgctgac
ggtttaacatgcgcattttcaggtacacacatgggtgtttatggcggagaagttgcgaag
gaagatgggatttctcgcgaagcgcaagatgaatgggcatatcgtagccatcagcgtgcg
gtttcagcgcataaagaaggacgttttgaagaggaaatcgtaccagtaacgatcccgcaa
agaaaaggcgatcctattgttgttgcaaaggatgaggcgccacgtgaagatacaacgatt
gaaaagttagcaaagttaaaacctgtatttgataaggaagcggcggtgacagctggtaat
gcgccaggactaaacgatggtggtgccgcacttgtgttaatgagcgaagacagagcgaag
caagaaggaagaaagccattagcgacaattttggcgcatacagcaattgcagtggaatct
aaagatttcccaagaacgccaggttatgcaattaacgcattgcttgaaaaaacaggaaag
acaattgaagacatcgatttattcgagattaatgaagcatttgcagcggtagcaattgca
agtacagaaatcgcaggaattgatccagaaaaattgaatgtaaatggcggcgcggtagcg
atgggccatccaattggagcaagcggagcgcgcattatcgttacactaatccatgcactt
aagcagcgcggcggcggaattggaattgcatcgatttgtagcggtggcggtcaaggagac
gcagtgatgattgaagttcactaa

DBGET integrated database retrieval system