KEGG   Bacteroides thetaiotaomicron VPI-5482: BT_4738
Entry
BT_4738           CDS       T00122                                 

Name
(GenBank) formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
bth  Bacteroides thetaiotaomicron VPI-5482
Pathway
bth00620  Pyruvate metabolism
bth00640  Propanoate metabolism
bth00650  Butanoate metabolism
bth01100  Metabolic pathways
bth01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BT_4738
   00640 Propanoate metabolism
    BT_4738
   00650 Butanoate metabolism
    BT_4738
Enzymes [BR:bth01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     BT_4738
SSDB
Motif
Pfam: PFL-like Gly_radical Coatomer_WDAD
Other DBs
NCBI-ProteinID: AAO79843
UniProt: Q89YJ3
Position
complement(6214685..6216913)
AA seq 742 aa
MELNKIFKDGLWSSEINVRDFVSHNITPYYGDASFLEGPTERTKAVWNRCLEALAEEREN
NGVRSLDNVTVSTITSHKAGYIDKENELIVGLQTDELLKRAIKPFGGINVVSKACHENGV
EVDDRVKDIFTHYRKTHNDGVFDVYTEEIRSFRSLGFLTGLPDNYARGRIIGDYRRMALY
GIDRLIEAKKEDLHNLTGPMTDARIRLREEVAEQIKALKDMKVMGEYYGLDLSRPAYTAQ
EAVQWVYMAYLAAVKEQDGAAMSLGNVSSFLDIYLEYELSKGTITESFAQELIDQFVIKL
RMVRHLRMQSYNDIFAGDPTWVTESLGGRLNDGRTKVTKTSFRFLQTLYNLGPSPEPNLT
VLWSPELPEGFKEFCAKVSIDTSSIQYENDDLMREVRQSDDYGIACCVSYQEIGKQIQFF
GARCNLAKALLLAINGGRCENTGTVMVKNIPVLTSDTLKFEEVMDNYKKVLIEIARVYNE
AMNIIHYMHDKYYYEKAQMALVDTNPRINLAYGVAGLSIALDSLSAIKYAKVTARRNDIG
LTEGFDIEGEFPCFGNDNDKVDHLGVDLVYFFSEELKKLPVYKNARPTLSLLTITSNVMY
GKKTGATPDGRAKGVAFAPGANPMHGRDKNGAIASLSSVAKLRYRDSQDGISNTFSIVPK
SLGATDEDRIENLVTMMDGYFTKGAHHLNVNVLNRDMLYDAMEHPENYPQLTIRVSGYAV
NFVKLSREHQLEVISRSFHERM
NT seq 2229 nt   +upstreamnt  +downstreamnt
atggaattaaacaagatctttaaagacggtctttggagcagcgaaatcaacgtcagagat
ttcgtaagtcataacatcactccgtattacggagatgcttcattcctcgaaggacctaca
gaacgtaccaaagccgtatggaaccgctgcctcgaagcgttggcagaagaaagagaaaac
aacggtgtccgctcattagataatgttaccgtatcaaccatcacttcccacaaggccgga
tatatcgacaaggaaaacgaactgatcgtcggcctgcagacagacgaacttctgaaacgt
gccatcaagcctttcggaggtatcaacgtagtcagcaaagcctgtcacgaaaacggcgtg
gaagtggacgaccgcgtaaaagatattttcactcactaccgcaagacgcacaacgacgga
gtattcgacgtatatacggaagaaatccgttccttccgttcgctgggattccttaccgga
cttcccgacaactatgcacgcggacgcatcatcggtgactaccgccgtatggctctttac
ggcatcgaccgtctgatcgaagcaaagaaggaagatttgcacaacctcaccggtccgatg
acagatgcccgtatccgtctgcgcgaagaagtggcagaacagatcaaggcactgaaagac
atgaaagtgatgggcgaatactacggtctcgacctgagccgtcccgcttacacggcacaa
gaagccgtacagtgggtatatatggcttaccttgccgccgtcaaagaacaagacggtgcc
gccatgtcactgggtaacgtttcttctttcctcgatatctatctggaatatgaactgagc
aaaggaaccatcaccgaatcgttcgcgcaagagctgatcgaccagtttgtcatcaaactg
cgtatggtccgccacctgcgtatgcaatcatacaacgacatctttgcaggcgacccgacc
tgggtaaccgaatctctgggcggacgtctcaacgacggacgtaccaaagtgacaaagacc
tccttccgtttcctgcagacattgtacaacctcggcccttcaccggaaccgaacctgacc
gtactctggagcccggaacttcccgaaggattcaaagaattctgtgcaaaggtttctatc
gacacttcttctatccagtacgaaaacgacgacctgatgcgtgaagtacgtcagtccgac
gactacggaatcgcctgctgcgtatcataccaggaaataggcaagcagattcagttcttc
ggtgcccgttgcaacctggccaaagccctgttgcttgccatcaacggcggacgttgcgag
aataccggtacagtcatggtgaagaacatccccgtactgaccagtgacacgctgaagttc
gaagaagtaatggacaactacaagaaagtactgatcgaaatcgcccgcgtatacaacgaa
gcgatgaacatcatccactatatgcacgacaagtattattacgagaaagcccagatggct
cttgtagatacgaacccgcgcataaaccttgcttacggtgtagccggactttccatcgca
ctcgattcactgtctgccatcaaatatgcgaaagtaactgcccgccgcaacgatatcggt
ctgacagaaggcttcgacatcgaaggagaattcccttgcttcggtaacgacaacgacaag
gtagaccaccttggcgtagacctggtatacttcttcagcgaagaattgaagaaattgcct
gtttacaagaatgcccgtcctaccctctccttgctgactatcacttccaatgtgatgtac
ggcaaaaagaccggtgctactcccgacggacgtgccaaaggtgttgccttcgctccgggt
gccaacccgatgcacggacgcgacaagaatggtgcgatcgcttctctgagctctgtagcg
aaacttcgttaccgtgactcacaggacggtatcagcaacaccttctctatcgttccgaaa
tcactgggtgctacggacgaagaccgtatcgagaacctcgtaacgatgatggacggttac
ttcaccaaaggtgcccaccacctgaacgtaaacgtactgaaccgtgatatgctatacgat
gccatggagcatccggagaactatccgcagctgaccatccgcgtttccggttatgccgta
aacttcgtgaagttgagccgcgaacaccaactggaagttatcagccgtagcttccacgaa
cgtatgtaa

DBGET integrated database retrieval system