KEGG   Bacteroides thetaiotaomicron VPI-5482: BT_0311Help
Entry
BT_0311           CDS       T00122                                 

Definition
(RefSeq) lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bth  Bacteroides thetaiotaomicron VPI-5482
Pathway
bth00020  Citrate cycle (TCA cycle)
bth00310  Lysine degradation
bth01100  Metabolic pathways
bth01110  Biosynthesis of secondary metabolites
bth01120  Microbial metabolism in diverse environments
bth01130  Biosynthesis of antibiotics
bth01200  Carbon metabolism
Module
bth_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bth_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bth00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BT_0311
  Amino acid metabolism
   00310 Lysine degradation
    BT_0311
Enzymes [BR:bth01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BT_0311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding HlyD_3 GCV_H RnfC_N
Motif
Other DBs
NCBI-GeneID: 1071659
NCBI-ProteinID: NP_809224
UniProt: Q8AB01
Position
373622..374992
Genome map
AA seq 456 aa AA seqDB search
MSRFEIKMPKLGESITEGTIVSWSVKVGDVIQEDDVLFEVNTAKVSAEIPSPVAGKVVEI
LFKEGDTVAVGTVVAVVDMGGEEASDEETASGKETPESKENASSDAEKVSSQVAKAEERW
YSPVVIQLARGANIPKEELDSIQGTGYEGRLSKKDIKDYIEKKKRGISEVSKAAIPTGDA
LTASMPSSTGGAGSMTTSPVAASVQTPVAAPSAPSKQAPAAANIPGVEVKEMDRVRRIIA
DHMVMSKKVSPHVTNVVEVDVTKLVRWREKNKDAFFRREGVKLTYMPVITEAVAKALAAY
PQVNVSVDGYNILFKKHINIGIAVSLNDGNLIVPVVHDADHLNLNGLAVAIDSLALKARD
NKLMPDDIDGGTFTITNFGTFKSLFGTPVINQPQVAILGVGYIEKKPAVIETPEGDTIAI
RHKMYLSLSYDHRVVDGMLGGNFLHFIADYLENWKG
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagattcgaaataaaaatgcctaagttgggcgagagtataaccgaagggacgatt
gtctcttggtctgtgaaagtgggggatgtcattcaggaagacgatgttctcttcgaggta
aatacggcgaaagtcagtgcggaaataccttcaccggtagctggtaaggtagtggaaatt
ctgtttaaggaaggagatacagtcgctgtaggtacagtggttgctgttgtagatatggga
ggtgaagaggcatccgatgaagaaactgcaagtggaaaagaaactccagaaagtaaggag
aatgcttcttctgatgcagaaaaagtatcttctcaggtagcaaaggctgaggaacgctgg
tattctcctgtggtgattcaattggcacgaggtgcaaatattccgaaagaagaacttgat
tcgatacaaggcacaggatacgaaggccggttaagcaagaaagatataaaggattatatt
gagaagaagaaaaggggaatttccgaagtctcgaaggcggcgatacctaccggtgatgca
cttacggcttctatgccttcttcgactggaggggctggctctatgacaacttctcctgtg
gcggcttccgtgcaaactcctgttgctgcaccgtctgctccatctaaacaagcacctgca
gctgctaatattccgggagtagaagtgaaagaaatggatcgtgtccgccggattattgcg
gatcatatggtgatgtccaagaaggtttcaccacacgtaaccaatgtagtagaggtagac
gtaaccaaactggtacgctggcgtgaaaagaataaagacgctttcttccgccgtgaggga
gtgaaactgacctatatgcctgtcataacagaagctgttgcaaaagcattggcagcatat
cctcaggtcaatgtatctgttgacggatataatattcttttcaagaaacatatcaatatc
ggtattgctgtttctttgaatgatggcaatctgatagttcctgtggtacacgatgccgat
catctgaacttgaatggattggctgtagctatagactcgctggcattgaaggctcgtgat
aacaaattgatgccagatgatattgacggaggtacgtttaccattactaatttcggtaca
ttcaagagtttgttcggtacgccggtgatcaatcagccccaggttgccattttgggagtg
ggatatattgagaagaagcctgccgtaatagagacaccggaaggtgatacgattgctatc
cgtcataagatgtatctgtccctgtcttatgaccatcgtgtagttgacggtatgctggga
ggcaacttcctgcacttcatagccgattacctggaaaactggaagggctga

DBGET integrated database retrieval system