KEGG   Bacteroides thetaiotaomicron VPI-5482: BT_1815Help
Entry
BT_1815           CDS       T00122                                 

Definition
(RefSeq) low-specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
bth  Bacteroides thetaiotaomicron VPI-5482
Pathway
bth00260  Glycine, serine and threonine metabolism
bth01100  Metabolic pathways
bth01110  Biosynthesis of secondary metabolites
bth01120  Microbial metabolism in diverse environments
bth01130  Biosynthesis of antibiotics
bth01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bth00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BT_1815
Enzymes [BR:bth01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BT_1815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-GeneID: 1075246
NCBI-ProteinID: NP_810728
UniProt: Q8A6R1
Position
complement(2277969..2278982)
Genome map
AA seq 337 aa AA seqDB search
MRSFASDNNSGVHPLVMEALSRANADHALGYGDDRWTEEAVAKIKETFTQDCVPLFVFNG
TGSNVVALQVMTRPYHSIFCAETAHIYVDECGSPVKMTGCQIRPIATTDGKLTPELMQPY
LHGFGDQHHSQPRALYISQCTELGTIYTPEELKRLTDFAHLNGMYVHMDGARIANACAAL
HLSLKELTVDCGIDILSFGGTKNGLMMGECVIIFNKDLQREARFVRKQSAQLASKMRYLS
CQFTTYLTDDLWLKNAAHANAMAGKLYRALKELPEVTFTQKPESNQLFLTMPRPTIDRML
ESYFFYFWNEANHEIRLVTSFDTTEEDVNQFIRLLRR
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgagaagttttgcctctgataataattccggtgtgcatccgttggtgatggaagcattg
agccgggcaaacgcagatcatgcgttgggttatggtgatgatcgatggacggaagaagcc
gtagccaagataaaagaaacctttacacaggactgtgtccctttgtttgtattcaatggc
acgggcagcaatgtggtggctttgcaagtaatgacgcgtccgtatcattcaatcttctgt
gcagaaactgcccatatttatgtagacgagtgcggctctcccgtgaaaatgacaggttgt
cagattcggccgattgccacaaccgatggtaagttgactcccgaactgatgcagccttat
ctgcacggtttcggcgaccagcatcattcgcaaccccgtgcgctttacatctctcaatgc
accgaactcggaacgatttatacacccgaagaactgaaacgtctgactgactttgcccat
ctgaacggtatgtatgtccacatggacggagcaaggattgccaatgcctgtgccgctctt
catctttcgctcaaagaactgactgtagactgtggaattgacatccttagtttcggcgga
acaaaaaacggactgatgatgggggaatgtgtgattatatttaataaggacctgcaacgg
gaagcccgttttgtccggaaacaatctgcccaactggcttccaagatgcgttacctttcc
tgtcagtttactacctacttgacggatgacctgtggctgaagaatgccgctcatgccaat
gcgatggcaggcaagctctatcgggcacttaaggaactgcccgaagtcacctttacccaa
aagccggagagcaaccagttatttctgaccatgccccgtccgactatcgaccggatgctg
gaatcttatttcttttatttctggaatgaggcgaatcacgaaatccgcctggtgacttct
tttgacacaacggaagaggatgtaaatcaatttattcgacttttgagacgttaa

DBGET integrated database retrieval system