KEGG   Bacteroides thetaiotaomicron VPI-5482: BT_2009Help
Entry
BT_2009           CDS       T00122                                 

Gene name
gmk
Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
bth  Bacteroides thetaiotaomicron VPI-5482
Pathway
bth00230  Purine metabolism
bth01100  Metabolic pathways
Module
bth_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bth00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BT_2009 (gmk)
Enzymes [BR:bth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     BT_2009 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 RsgA_GTPase AAA_16 AAA_33 AAA_22 AAA_29 ABC_tran Thymidylate_kin AAA_23 T2SSE CPT
Motif
Other DBs
NCBI-GeneID: 1074911
NCBI-ProteinID: NP_810922
UniProt: Q8A677
Position
2525126..2525740
Genome map
AA seq 204 aa AA seqDB search
MSTFSVFNFQFSIKQMTGKLIIFSAPSGSGKSTIINYLLTQNLNLAFSISATSRPPRGTE
KHGVEYFFLTPEEFRCRIENNEFLEYEEVYKDRYYGTLKEQVEKQLEKGQNVVFDLDVVG
GCNIKKYYGERALSIFVQPPSIEELRCRLTGRGTDEPEVIECRIAKAEYEMTFAPQFDRV
IVNDDLEAAKAETLEVIKEFLNKE
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacattttcagttttcaactttcaattctcaattaaacaaatgactggcaagtta
attattttttctgccccgtccggttcgggcaaatcgactattatcaactatctgctgacg
cagaacttaaatctcgcgttctccatttctgcaaccagccgcccaccgcgcgggacggag
aaacacggggtcgaatatttcttccttactcccgaagagttccgttgtcgcattgagaac
aacgagtttttggaatacgaagaagtatacaaggatcggtattacggaacgctgaaagaa
caagtggaaaagcagttggagaaggggcagaacgtagtattcgacttggatgtagtaggc
ggatgcaacatcaaaaagtattacggtgagcgtgcattgtccatctttgtacagccgccc
tccatcgaagaactccgttgccggctgacgggtcggggcacggatgagcccgaagtaatc
gaatgccgcatcgcaaaggcggaatacgaaatgacttttgctccccagtttgatcgtgtc
atcgtgaatgatgatctggaagcggcaaaggctgagacgctggaggttatcaaagaattt
ctgaataaggaatga

DBGET integrated database retrieval system