KEGG   Bacteroides thetaiotaomicron VPI-5482: BT_2571Help
Entry
BT_2571           CDS       T00122                                 

Definition
(RefSeq) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
bth  Bacteroides thetaiotaomicron VPI-5482
Pathway
bth00220  Arginine biosynthesis
bth00250  Alanine, aspartate and glutamate metabolism
bth00471  D-Glutamine and D-glutamate metabolism
bth01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bth00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BT_2571
   00220 Arginine biosynthesis
    BT_2571
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BT_2571
Enzymes [BR:bth01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     BT_2571
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase Beta-lactamase
Motif
Other DBs
NCBI-GeneID: 1072193
NCBI-ProteinID: NP_811484
UniProt: Q8A4M8
Position
3208980..3209945
Genome map
AA seq 321 aa AA seqDB search
MDKKVTLAQLKEVVQEAYDQVKTNTGGKNADYIPYLANVNKDLFGISVCLLNGQTIHVGD
TDYRFGIESVSKVHTAILALRQYGAKEILDKIGADATGLPFNSIIAILLENDHPSTPLVN
AGAISACSMVQPIGDSAKKWDAIVENVTDLCGSAPQLIDELYKSESDTNFNNRSIAWLLK
NYNRIYDDPDMALDLYTRQCSLGVTALQLSVAAGTIANGGVNPVTKKEVFDASLAPKITA
MIAAVGFYEHTGDWMYTSGIPAKTGVGGGVMGVLPGQFGIAAFAPPLDGAGNSVKAQLAI
QYVMNKLGLNVFSDNHLIVVD
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaaaagtaacactcgctcaattgaaagaagtggtacaggaggcatacgatcag
gtgaaaacgaatacaggcggtaagaatgccgactatatcccttatctggccaatgtcaac
aaagatctctttggaatcagtgtctgcctgctcaacgggcagaccatccatgtgggagat
actgactaccgcttcggcatcgaatccgtatccaaagtacatacggctatccttgcactg
cgccaatatggtgccaaagaaatattagacaagatcggagctgacgcaacgggcctgcct
ttcaattcaatcattgctatcctgctggaaaatgaccatccgtctaccccgttggtaaac
gccggtgccatctccgcctgcagtatggtacaacctatcggcgactctgccaagaagtgg
gatgccatcgtagagaacgtgaccgatttatgcggcagcgctccccagctgattgatgaa
ttgtacaaatccgaatcggatacgaacttcaacaaccgctccattgcgtggttgctgaag
aactacaaccgtatttatgatgatccggatatggcgctggacctgtatacccgccaatgc
tcattgggagtaacggccttgcagctttctgtggcagccggaacaatcgccaacggtggt
gtgaatccggtgacaaagaaagaagtattcgatgccagcctcgctcccaagatcactgca
atgatcgctgccgtaggtttctacgagcatacaggagactggatgtatacctccggcatt
ccggctaaaaccggtgtaggcggtggtgtaatgggcgtattgcccgggcagttcggtatt
gccgcattcgctcctcctttggatggtgcaggcaattcggtaaaagcacaattggctatc
caatatgtcatgaataaactgggactgaatgtattcagtgacaatcacttgatcgtagtc
gactag

DBGET integrated database retrieval system