KEGG   Bacteroides thetaiotaomicron VPI-5482: BT_3687
Entry
BT_3687           CDS       T00122                                 

Definition
(RefSeq) hypothetical protein
Organism
bth  Bacteroides thetaiotaomicron VPI-5482
SSDB
Motif
Pfam: Glyco_hydro_88 SnoaL_4
Other DBs
NCBI-GeneID: 1071959
NCBI-ProteinID: NP_812598
UniProt: Q8A1H4
Structure
PDB: 
5NOA

Position
4790893..4792038
AA seq 381 aa
MKKLYATLFSALVVGCAVCAGCTTKKVSSSAEVVDIIHKVNGYWQTNHPEHGRSFWDNAA
YHTGNMEAYFLTNKPEYLEYSKGWAEHNEWKGAKSDHKANWKYSYGESNDYVLFGDYQIC
FQTYADLYNLEPDTHKIARAREVMEYQMSTPNNDYWWWADGLYMVMPVMTKLYNITKNPL
YLEKLHEYLAYADSIMYDEEAGLYYRDGKYVYPKHKSVNGKKDFWARGDGWVLAGLAKVL
KDLPETDKYRQEYIDRFRTLAKSVAACQQPEGYWTRSMLDAQHAPGPETSGTAFFTYGLQ
WGVNNGFLDSAHYQPVVEKAWKYLSTVALQPDGKIGYVQPIGEKAIPGQVVDANSTSNFG
VGAFLLAACERVRYLESLIQH
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgaagaaattgtatgcaactcttttttccgcactggtggtaggctgtgcggtgtgtgcc
ggttgcacaaccaagaaagtttcatcttcggcagaagtggttgacattattcataaagtc
aatggctactggcagacaaaccatccggaacacgggcgttctttctgggacaatgccgct
tatcataccggaaacatggaggcttacttcctgaccaacaaaccggaatacctggaatac
tcaaaaggatgggcggaacataatgagtggaaaggcgctaaatcggatcataaagccaac
tggaagtacagttatggcgaaagcaatgattatgtactgttcggcgattatcagatctgt
tttcagacgtatgccgatttatataatctggaaccggatacacataagatagcccgtgcc
cgtgaggtgatggagtatcagatgagtacacccaacaatgattattggtggtgggcggat
ggtttatatatggtaatgcctgtgatgaccaaactatataatatcacaaaaaatccactt
tacctggagaaactgcatgaatacctcgcttatgcagacagtatcatgtatgatgaagaa
gccggactttactatcgcgatggaaaatacgtataccccaagcacaaaagtgtgaatggt
aaaaaggatttctgggcacgtggtgatggctgggtactggcggggctggcgaaagtcttg
aaagaccttccggaaacagataagtatcgtcaggaatatatagaccgtttccgtacattg
gcaaaatctgttgcggcctgtcagcaacctgaagggtattggacgcgtagtatgctcgat
gcgcagcatgcaccgggacccgaaacaagtggtacggcattctttacgtacggtctgcaa
tggggggtcaataacggtttccttgactccgcccattatcaacctgtagttgagaaggca
tggaaatatttgtcaacagttgctttacagcccgacggaaagatcggttatgtgcaaccc
atcggcgagaaagccataccggggcaagtcgtagatgctaattctacttcaaacttcgga
gtcggtgctttcctgctggcagcttgtgaaagggtacgttatctggaatcacttattcag
cattaa

DBGET integrated database retrieval system