KEGG   Bacteroides thetaiotaomicron VPI-5482: BT_3868Help
Entry
BT_3868           CDS       T00122                                 

Definition
(RefSeq) glycosyl hydrolase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
bth  Bacteroides thetaiotaomicron VPI-5482
Pathway
bth00511  Other glycan degradation
bth00520  Amino sugar and nucleotide sugar metabolism
bth01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bth00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BT_3868
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BT_3868
Enzymes [BR:bth01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BT_3868
Chaperones and folding catalysts [BR:bth03110]
 Intramolecular chaperones
  Others
   BT_3868
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b Annexin
Motif
Other DBs
NCBI-GeneID: 1072979
NCBI-ProteinID: NP_812779
UniProt: Q8A103
Position
complement(5039698..5041683)
Genome map
AA seq 661 aa AA seqDB search
MRNKFVSLQALALLVIFCLTGSLTRAAVNPKPFVVPELKQWTGKDGNFTPGKDTRIVCTS
QNPELLRIARMFADDYQQMFGQTLSVAQGKATSGDFVLSLSADKKLGEEGYAIKITDRVA
ISAPTPTGLYWSTRTLLQLAEQNQERSLPQGTIRDYPDYPLRGFMIDCGRKFIPMAYLQD
LVKIMAYYKMNTLQVHLNDNGFKQYFEHNWDKTYAAFRLESETYPGLTARDGSYSKKEFI
DFQKQAASNFVEIIPEIDVPAHSLALTHYKPEIGSKEYGMDHLDLFKPETYEFVDALFKE
YLEGDNPVFVGKRVHIGTDEYSNAKKDVVEKFRAFTDHYIRFVEGFGKQAVVWGALSHAK
GDTPVKSENVVMNAWYNGYADPATMIKDGYQLISIPDGLVYIVPKAGYYYDYLNEPYLYK
EWTPAHIGKAVFDEKHPSILGGMFAIWNDHVGNGISVKDIHHRIFSPLQTLSVKMWTGAQ
TGIPYETFNEKRALLSEAPGVNQLARIGKKPELVYERSTVAPGSTSDYPEIGYNYTVSFD
ITGAKESEGTELFRSPNAVFYLSDPIRGMMGFARDGYLNTFPYKVNPGEKATIQIEGNNR
STTLRVNGKVVDEMNTQKLYFNAGKDSMNYVRTLVFPLEKAGNFNSKVQNLKVYNYCVSK
P
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgagaaacaagtttgtatctttgcaagctctggccttattggtcatcttttgtctgacg
ggtagcttaacccgtgccgctgtcaacccgaaaccgtttgttgtccccgaactcaaacaa
tggacgggaaaagacggtaacttcactccgggaaaagacacccgaatcgtctgcacttcc
caaaatcccgaattactgagaatagcccggatgttcgccgacgattatcaacagatgttc
gggcagacattaagcgtagcacaaggcaaagccacgtccggcgatttcgtcctatccttg
tcggcagacaagaagctcggtgaggaaggttacgccatcaagataaccgaccgtgtagcc
atctccgctcccaccccgaccggtctttactggagcacacgcacactcctgcaactggcg
gaacaaaatcaggaacgctcactcccgcaaggaacgattcgtgattatcccgattatccg
cttcgcggtttcatgatagactgtggccgtaagttcattccgatggcttatctgcaggac
ttggtgaaaatcatggcttactacaaaatgaacaccctgcaagtccatctgaacgataat
ggattcaagcaatacttcgaacacaactgggacaagacttacgctgccttccggctggaa
tcggagacttatccgggattgacagcccgtgacggctcgtactccaagaaagaattcatc
gatttccagaaacaagcggcatccaacttcgtggaaatcattccggaaattgacgttccc
gcccactcactggctctcacccattacaaaccggaaatcggaagcaaggagtacggcatg
gatcaccttgacttattcaagccggaaacttacgaattcgtagatgctctgttcaaagaa
tatctggagggcgacaatccggtattcgtaggcaagcgtgtacatatcggtacagacgaa
tactcgaacgcgaagaaagacgtggtagaaaaattccgtgctttcaccgaccattacatc
cgttttgtggaaggtttcggcaagcaagcagtcgtatggggcgcgctcagccatgccaaa
ggcgatacgcccgtcaaatcagaaaatgtcgtcatgaatgcttggtacaacggatacgcc
gatccggcaactatgatcaaagacggatatcaactgatcagtattccggacggactggta
tatatcgttccgaaagccggctactattatgattacctcaacgaaccatacttatataag
gagtggacacccgcccatatcggcaaagctgtattcgacgaaaaacatccttccattctt
ggcggtatgtttgccatctggaacgaccatgtcggcaacggtatctcggtgaaagacatc
catcaccgtatattctcgcccctgcaaacactctctgtaaagatgtggacaggcgctcaa
acgggcattccttatgaaacattcaatgaaaaacgtgccctcctcagcgaagcgcccgga
gtcaaccaactggcaagaatcggcaaaaagccggaattggtatacgaacgttccacagtc
gctcccggcagcacttccgattatccggaaattggctataattacactgtcagtttcgac
attaccggagcaaaagaaagtgaaggaaccgaattgttccgttcgcctaacgccgtattc
tatctgtcagaccctattcgggggatgatgggatttgcacgcgacggctatctgaatacc
ttcccctacaaagtgaatccgggagaaaaagcaacaattcagatagaaggaaacaatcgc
agcacaacgctgagagtcaacggtaaagtggttgatgaaatgaatacgcagaaactttac
tttaatgcgggaaaagattcaatgaactatgtacgtacactagttttcccgctggagaaa
gcaggaaactttaatagtaaggtacagaatctgaaagtatacaattattgcgtaagcaaa
ccataa

DBGET integrated database retrieval system