KEGG   Bacteroides thetaiotaomicron VPI-5482: BT_3911Help
Entry
BT_3911           CDS       T00122                                 

Definition
(RefSeq) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
bth  Bacteroides thetaiotaomicron VPI-5482
Pathway
bth00020  Citrate cycle (TCA cycle)
bth00270  Cysteine and methionine metabolism
bth00620  Pyruvate metabolism
bth00630  Glyoxylate and dicarboxylate metabolism
bth00680  Methane metabolism
bth01100  Metabolic pathways
bth01110  Biosynthesis of secondary metabolites
bth01120  Microbial metabolism in diverse environments
bth01130  Biosynthesis of antibiotics
bth01200  Carbon metabolism
Module
bth_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bth_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BT_3911
   00620 Pyruvate metabolism
    BT_3911
   00630 Glyoxylate and dicarboxylate metabolism
    BT_3911
  09102 Energy metabolism
   00680 Methane metabolism
    BT_3911
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BT_3911
Enzymes [BR:bth01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     BT_3911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C UDPG_MGDP_dh_N Glyco_hydro_4 3HCDH_N NAD_Gly3P_dh_N Pyr_redox_2 DUF2252 Pyr_redox
Motif
Other DBs
NCBI-GeneID: 1073026
NCBI-ProteinID: NP_812822
UniProt: Q8A0W0
Position
complement(5085583..5086524)
Genome map
AA seq 313 aa AA seqDB search
MSKVTVVGAGNVGATCANVLAFNEVADEVVMLDVKEGVSEGKAMDMMQTAQLLGFDTTVV
GCTNDYAQTANSDVVVITSGIPRKPGMTREELIGVNAGIVKSVAENILKYSPNAILVVIS
NPMDTMTYLSLKALGLPKNRIIGMGGALDSSRFKYFLSQALGCNANEVEGMVIGGHGDTT
MIPLTRFATYKGMPVTNFISEEKLNEVAAATMVGGATLTKLLGTSAWYAPGAAGAFVVES
ILHDQKKMIPCSVYLEGEYGESDICIGVPVILGKNGIEKIVELDLNADEKAKFAASAKAV
HGTNAALKEVGAL
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagtaaccgtagtaggcgcaggtaacgtaggtgctacatgtgcaaatgtactt
gctttcaatgaagtagcagacgaagtagtaatgctggacgttaaagaaggcgtttcagaa
ggtaaagcaatggatatgatgcagacagctcaactgttgggtttcgacacaactgtagta
ggctgcactaacgactatgctcagactgctaactctgacgttgttgtaattacttcaggt
attcctcgtaaaccgggtatgactcgcgaagaactgatcggtgtaaacgctggtatcgtt
aaatcagtggcagaaaacatcttgaaatattctcccaatgcaatccttgttgttatctct
aacccgatggatacaatgacttacctgtcattgaaagctctgggcttgccgaagaaccgc
atcatcggtatgggtggcgcactggacagctctcgtttcaaatatttcttgtctcaggct
ttgggctgcaacgccaacgaagtagaaggtatggttatcggtggtcacggtgatactact
atgattcctttgactcgcttcgctacttacaaaggtatgcctgtaactaacttcatctct
gaagaaaaactgaacgaagtggctgctgctactatggtaggtggtgctactctgactaag
ttactgggcacttctgcatggtatgcaccgggtgcagcaggagcattcgtagttgaatct
atccttcacgaccaaaagaagatgatcccttgttcagtatatctggaaggagaatacggt
gaatcagacatttgcatcggtgttcctgtaatccttggcaagaacggtatcgaaaagatc
gtcgaactggatctgaacgctgacgaaaaagctaagttcgctgccagcgcaaaagctgtt
cacggaacaaacgctgctttgaaagaagtaggtgctctgtaa

DBGET integrated database retrieval system