KEGG   Burkholderia thailandensis 2003015869: DR62_1250Help
Entry
DR62_1250         CDS       T03763                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
btha  Burkholderia thailandensis 2003015869
Pathway
btha00071  Fatty acid degradation
btha00072  Synthesis and degradation of ketone bodies
btha00280  Valine, leucine and isoleucine degradation
btha00310  Lysine degradation
btha00362  Benzoate degradation
btha00380  Tryptophan metabolism
btha00620  Pyruvate metabolism
btha00630  Glyoxylate and dicarboxylate metabolism
btha00640  Propanoate metabolism
btha00650  Butanoate metabolism
btha00900  Terpenoid backbone biosynthesis
btha01100  Metabolic pathways
btha01110  Biosynthesis of secondary metabolites
btha01120  Microbial metabolism in diverse environments
btha01130  Biosynthesis of antibiotics
btha01200  Carbon metabolism
btha01212  Fatty acid metabolism
btha02020  Two-component system
Brite
KEGG Orthology (KO) [BR:btha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DR62_1250
   00630 Glyoxylate and dicarboxylate metabolism
    DR62_1250
   00640 Propanoate metabolism
    DR62_1250
   00650 Butanoate metabolism
    DR62_1250
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DR62_1250
   00072 Synthesis and degradation of ketone bodies
    DR62_1250
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DR62_1250
   00310 Lysine degradation
    DR62_1250
   00380 Tryptophan metabolism
    DR62_1250
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DR62_1250
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DR62_1250
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DR62_1250
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:btha04147]
    DR62_1250
Enzymes [BR:btha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DR62_1250
Exosome [BR:btha04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DR62_1250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AIP63189
Position
1:1050555..1051760
Genome map
AA seq 401 aa AA seqDB search
MEAYIFDAVRTPRGKGKKDGSLHGVTPLALAATALRAIRDRNGLDTSAVDDVVLGCVEPV
GEQGACIGRIAVLAAGYAETTAGVQINRFCASGLEACNMAAAQVMSGQSDMAIGGGVESM
SRVPMGASGGAWPVDPAIAIPSYFVPQGVSADTIATKWGYSRADVDAYAAESHRRAHAAT
QAGWFARSIVPVRDANGLTILDRDETIRPQTTPETLATLKPSFAELGEMYGFDAVIRQRY
PELERIEHVHHAGNSSGIVDGAAAVLIGSLEAGKRAGLAPRARVRSFASVGSEPSIMLTG
PAYAAEKALKRAGMRAADIDLYELNEAFASVVLRFMDAMAIAHDRINVNGGAIAMGHPLG
ATGAMILGTLLDELERRGAATGLATLCVGAGMGTATIIERI
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggaagcctacattttcgacgccgtgcgcacgccgcgcggcaaaggcaagaaggacggc
agcctgcacggcgtcacgccgctcgcgctcgccgcaaccgcgctgcgcgcgatccgcgat
cgcaacggcctcgacacgagcgccgtcgacgacgtcgtgctcggctgcgtcgagcccgtc
ggcgagcagggcgcgtgcatcggccgcatcgcggtgctcgcggccggctacgcggaaacc
acggccggcgtgcagatcaaccgcttctgcgcgtcgggcctcgaggcgtgcaacatggcc
gccgcgcaggtgatgtccggccagtcggacatggcgatcggcggcggcgtcgagagcatg
tcgcgcgtgccgatgggcgcgagcggcggcgcgtggcccgtcgatccggcgatcgcgatt
ccgagctacttcgtgccgcagggcgtgtcggccgacacgatcgcgacgaagtggggctac
agccgagccgacgtcgacgcgtacgcagccgagagccaccgccgcgcgcacgcggcgacg
caggccggctggttcgcgcgctcgatcgtgccggtgcgcgacgcgaacggcctgacgatc
ctcgatcgcgacgagacgatccgcccgcagacgacgcccgagacgctcgcgacgctcaag
ccgtcgttcgccgaactgggcgagatgtacggcttcgacgcggtgatccgccagcgctat
ccggagctcgagcgcatcgagcacgtgcatcacgcgggcaacagctcggggatcgtcgac
ggcgcggcggccgtgctgatcggctcgctcgaggcgggcaagcgcgcgggcctcgcgccg
cgcgcgcgggtccgctcgttcgcgagcgtcggctcggagccgtcgatcatgctgacgggg
ccggcctacgcggccgagaaggcattgaagcgtgccggcatgcgcgcggccgacatcgat
ctgtacgagctgaacgaagcgttcgcatcggtcgtgctgcgcttcatggacgcgatggcg
attgcgcacgacaggatcaacgtgaacggcggtgcgatcgcgatgggccacccgctcggc
gcgacgggcgcgatgatcctcggcacgctgctcgacgaactcgagcggcgcggcgcggcc
acgggcctcgcaacgctgtgcgtcggcgccggcatgggcacggcgaccatcatcgaacgg
atttga

DBGET integrated database retrieval system