KEGG   Burkholderia thailandensis 2003015869: DR62_1648Help
Entry
DR62_1648         CDS       T03763                                 

Definition
(GenBank) cytochrome d ubiquinol oxidase subunit 2
  KO
K00426  cytochrome bd ubiquinol oxidase subunit II [EC:7.1.1.7]
Organism
btha  Burkholderia thailandensis 2003015869
Pathway
btha00190  Oxidative phosphorylation
btha02020  Two-component system
Module
btha_M00153  Cytochrome bd ubiquinol oxidase
Brite
KEGG Orthology (KO) [BR:btha00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DR62_1648
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DR62_1648
Enzymes [BR:btha01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.7  ubiquinol oxidase (electrogenic, proton-motive force generating)
     DR62_1648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cyt_bd_oxida_II DUF4239
Motif
Other DBs
NCBI-ProteinID: AIP63338
UniProt: A0A1B4JSM6
Position
1:complement(1482483..1483619)
Genome map
AA seq 378 aa AA seqDB search
MDYATLKVIWWLLVGILLIGFALTDGFDMGAAALLPFLGKTDDERRIIVNTVGATWEGNQ
VWLITAGGAMFAAWPLVYAASFSGFYFAMLLVLFALFFRPVGFDYRSKRDDPRWRTSWDW
ALFVGGFVPALVFGVAFGNLLQGVPFAFDTDLRVTYHGSFWALLNPFALLCGLVSLTMLV
AHGAAFVKMKTDGAIAKRASIALRVSSLVAVVLFVLAGALIASFVGGFQITQAAPVDTVA
NPLLKQVSAAPGLWLVNYGLYPWMIAAPAVGIAGGVLAMLLAGSKREKTAFICTGLMIIG
VILTAGFSMFPFIMPSSLDPKSSLTVWDSTSSRLTLEVMLVAVIVFLPIILLYTSWVYRV
LRGKVTPSVLEENRHSMY
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggactatgcaactctgaaagtgatctggtggctgctcgtcgggatactgctcatcggc
ttcgcgctgacggacggcttcgacatgggcgcggccgcgcttctgccgttcctcggcaag
accgacgacgagcgccgcatcatcgtcaacacggtcggcgcgacctgggagggcaaccag
gtctggctcatcaccgcgggcggcgcgatgttcgccgcgtggccgctcgtttatgcggcg
tcgttttcgggcttctacttcgcgatgctgctcgtgctgttcgcgctgttcttccggccc
gtcggcttcgactaccgcagcaagcgcgacgatccgcgctggcgcacgagttgggattgg
gcgctcttcgtcggcggcttcgtgcccgcgctcgtgttcggcgtcgcattcggcaacctg
ctgcagggcgtgccgttcgcgttcgacaccgacctgcgcgtcacctatcacggcagcttc
tgggcgctgctcaatccgttcgcgctgctctgcgggctcgtgagcctcacgatgctcgtc
gcgcacggcgccgcattcgtcaagatgaagaccgacggtgcgatcgcgaagcgcgcgtcg
atcgcgctgcgcgtgtcgtcgctcgtcgccgttgtgctgttcgtgctcgcgggcgcgctg
atcgcgtcgttcgtcggcggcttccagatcacgcaggcggcccccgtcgacaccgtcgca
aatccgctcctcaagcaggtctccgccgcgccgggcctctggctcgtgaactacgggctg
tatccgtggatgatcgccgcgcccgccgtcggcatcgcgggcggcgtgctcgcgatgctg
cttgccggctcgaagcgcgagaagaccgcgttcatctgcacgggcctgatgatcatcggc
gtgatcctgacggcgggcttctcgatgttcccgttcatcatgccttcgtcgctcgatccg
aagagcagcctgacggtctgggattcgacatcgagccggttgacgctcgaggtgatgctc
gtcgcggtgatcgtgttcctgccgatcatcctgctctacacgagctgggtgtatcgcgtg
ctgcgcggcaaggtgacgccgagcgtgctggaggaaaaccggcactcgatgtactga

DBGET integrated database retrieval system