KEGG   Burkholderia thailandensis 2003015869: DR62_1740Help
Entry
DR62_1740         CDS       T03763                                 

Definition
(GenBank) alpha/beta hydrolase
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
btha  Burkholderia thailandensis 2003015869
Pathway
btha00903  Limonene and pinene degradation
btha00930  Caprolactam degradation
btha01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:btha00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    DR62_1740
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    DR62_1740
Enzymes [BR:btha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     DR62_1740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Hydrolase_4 Abhydrolase_2 Peptidase_S9
Motif
Other DBs
NCBI-ProteinID: AIP63153
UniProt: A0A2N8QYI0
Position
1:1596215..1597180
Genome map
AA seq 321 aa AA seqDB search
MSWQSKVACWLLRRQFRPETLRPVIDPARARRLTKLRMRVPRRPPAGWRLRERYGAGDAP
LRGEWLERADAVPVRAQHGRMLLYFHGGGYYFCSPQTHRPLVFALTRHAGVRSFSLDYRL
APEHPFPAALDDALAAYRQLVSAGTPPESIVFGGDSAGGGLALAALVALRDAGDPLPAGA
VLFSPWTDLAATGDTLRTHDGLDPMFAGAALGRAARLYLGDTPGTHPHASPLYADFTGLP
PLFIQAGSTEVLLDDSRRVADKARAAGVHVELEIWPQMPHVWQIYVPFVPESARALERAA
AFVRRIAVERATQRTADASIA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgagttggcagagcaaagtcgcgtgctggctgctgcgccggcagtttcgtcctgagacg
ctgcgccccgtgatcgacccggctcgcgcgcggcggctgacgaagctgcggatgcgcgtg
ccgcgccgcccgcccgccggctggcggctgcgcgagcgctacggcgccggcgacgcgccg
ctgcgcggcgaatggctcgagcgcgcggacgccgtgcccgttcgcgcgcagcatggccgg
atgctgctgtatttccacggcggcggttattacttctgctcgcctcagacgcaccgcccg
ctcgtgttcgcgctgacgcggcacgcgggcgtgcgctcgttctcgctcgactaccggctc
gcacccgagcatccgtttccggccgcgctcgacgacgcgctcgccgcgtaccggcaactc
gtgtccgccggcacgccgccggagtcgatcgtgttcggcggcgattcggcgggcggcggc
ctcgcgctcgccgcgctcgtcgcgctgcgcgacgcgggcgacccgctgccggcgggcgcg
gtgctgttctcgccgtggaccgatctcgccgcgacgggcgatacgctgcgcacgcacgac
gggctcgatccgatgttcgcgggcgcggcgctcggccgcgcggcgcgcctgtatcttggt
gacacgccgggcacgcatccgcatgcgtcgccgctgtatgcggatttcacgggattgccg
ccgcttttcatccaggcgggcagcaccgaggtgctgctcgacgattcgcggcgcgtcgcc
gacaaggcgcgcgcggcgggcgtgcacgtcgaactagagatatggccgcagatgccgcac
gtatggcagatctacgtgccgttcgtgcccgaatcggcgcgtgcgctcgagcgggcggcc
gcgttcgtgcggcgcatcgcggtcgagcgcgcgactcagcgcacggccgacgcgtcgatc
gcctga

DBGET integrated database retrieval system