KEGG   Burkholderia thailandensis 2003015869: DR62_2391Help
Entry
DR62_2391         CDS       T03763                                 

Definition
(GenBank) exodeoxyribonuclease V subunit gamma
  KO
K03583  exodeoxyribonuclease V gamma subunit [EC:3.1.11.5]
Organism
btha  Burkholderia thailandensis 2003015869
Pathway
btha03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:btha00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    DR62_2391
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:btha03400]
    DR62_2391
Enzymes [BR:btha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     DR62_2391
DNA repair and recombination proteins [BR:btha03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     DR62_2391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_V_gamma RecC_C
Motif
Other DBs
NCBI-ProteinID: AIP64751
UniProt: A0A5F1BXV5
Position
1:2318443..2321787
Genome map
AA seq 1114 aa AA seqDB search
MLHLFYSNRHETLAAALLDDLAFASDGAGPWAAQQVIVPSAALRRRLELDVAKRHGVCAN
VRFSYLAQWLWAQIGEVLTVPAHSPFAPDRLVWRCYRLLSDDGAAPWRGSPRLAAYLAAA
DAPMRHELAQRIATVFDHYLTYRPEWLAQWQDGESIFALEGAPRHGGEAARDDEAWQAAL
WRALLAELSDSGMPPAHRFLREAGTFDPGVIAHAQAKWPDAVSVFALPTMPPLHIALLRE
LSRWIDVRIYALNPCREFWFDIVTAARVESLDAADQLDYQQVGHPLLAEWGRQTQAQLHM
LHELTESAAASDASRYAENPAPTWLARVQNAILDLQPEDALGAPPAERGVEVHVCHSLAR
QLEVLHDRLLAWFDADPSLAPSDVLVAMPDLAAAGPLIDAVFGTSSGADAARIPYRITGL
PPSHANPVARVLLDWLALPERNVGAPELVEWLRADAIAARYGIDATALETVQTWLAASGA
RRGLAPDAAEPPNAAVPAPRHTFADALTRLFLGYAMPDGAAPVSTWLPIAGAEGGEAELL
GRLARFTDDLDGFAQRIARDLTPQDWGDVFADALARFFDSGPAFADALSGVRDALDAMLA
AMAEGAGRAELPAAVVRAGLAAALDDPARGGVPWGGVTFSSLTSLRGLPYRIVCLIGMDD
GVLPSLARADEFDLMAVFAKLGDRQRRDDERNLFLDLLLAARDRLLIAYTGRSIRDNAPL
PPAALVDELLDHLATVSAGPDASPDAVDAARRAFVIEHPLQPFSADYFAPGGALFTYDAS
RATLARLLAEGGRAQALPFFSEPLPAEPAEPVAFADFERFWRHPARSLLRARLGIVLWDA
QAELVDTEPFELDYAGSDALAGRVLPLLIETADAGAFEHALRVADASPEVPGGATGAVRR
DHELDALAQLAGNVRRALADGAARVPFALDVAPAWPAAGDAPWFGEHDAALASAATREPL
RLHGALARLTAAGQVIYRYARPGARDYLSAWLAHLVYCAIDPAGPRRTLWLGCGDTFEFA
PVAAPLEQLAPLAALFRAGRRMPLAFFPRSAWALVSESESKAAGVWINDRVAGEADDAAL
ALAWRGANPSLDEPFGALAHLVFDPLVEHLRRAS
NT seq 3345 nt NT seq  +upstreamnt  +downstreamnt
atgctccatctcttctactcgaaccgccacgaaacgctggccgccgcgctgctcgacgat
ctcgccttcgcgtcggacggcgcgggcccctgggccgcgcagcaggtgatcgtgccgagc
gcggcgctgcgccggcggctcgagctcgacgtcgcgaagcggcacggcgtgtgcgcgaac
gtgcgcttcagctatctcgcgcaatggctgtgggcgcagatcggcgaggtgctgacggtg
cccgcgcactcgccgttcgcgcccgatcgtctcgtctggcgctgctaccggctgctgtcg
gacgacggcgccgcgccgtggcgcggctcgccgcggctcgccgcgtatctggccgcggcc
gatgcgccgatgcgccacgagctcgcgcagcggatcgcgacggtgttcgaccactacctc
acgtatcgcccggaatggctcgcgcaatggcaggacggcgaatcgatcttcgcgctcgaa
ggcgcgccgcgccacggcggcgaggccgcgcgcgacgacgaggcgtggcaggccgcgctc
tggcgcgcgctgctcgcggagctgtccgacagcgggatgccgcccgcgcaccggttcctg
cgcgaggccggcacgttcgatcccggcgtgatcgcgcacgcgcaagcgaagtggccggat
gcggtcagcgtgttcgcgctgccgacgatgccgccgctgcacatcgcgctgctgcgcgaa
ctgtcgcgctggatcgacgtgcgcatctacgcgctcaatccgtgccgcgagttctggttc
gacatcgtcacggccgcgcgcgtcgagtcgctcgacgcggcggaccagctcgactatcag
caagtcggtcacccgctcctcgccgaatggggcaggcagacgcaggcgcaattgcacatg
ctgcacgagctgaccgagagcgcggcggcgagcgatgcgtcgcgctacgcggagaatccc
gcgccgacgtggctcgcgcgcgtgcagaacgcaattctcgatctgcagccggaggatgcg
ctcggcgcgccgcccgccgagcgcggcgtcgaagttcacgtgtgccacagcctcgcgcgc
cagctcgaggtgctgcacgaccgcctcctcgcgtggttcgacgcggacccgagcctcgcg
ccgtcggacgtgctcgtcgcgatgccggatctcgcggcggcggggccgctcatcgacgcg
gtgttcggcacgtcgtcgggcgccgacgccgcgcgcatcccgtaccggatcaccggcctg
ccgccatcgcacgcgaatcccgtcgcacgcgtgctgctcgactggctcgcgctgcccgag
cgcaacgtcggcgcgccggagttggtcgagtggctgcgcgccgacgcgatcgccgcgcgc
tacgggattgacgcgacggcgctcgaaaccgtgcagacgtggctcgccgcgtcgggcgcg
cggcgcgggctcgcgcccgacgcggccgaaccgccgaacgccgccgtgcccgcgccgcgc
cacacgttcgccgatgcgctcacgcggctgttcctcggctatgcgatgcccgacggcgcg
gcgcccgtctcgacctggctgccgatcgcgggcgcggagggcggcgaggccgagctgctc
ggcaggctcgcgcgcttcaccgacgatctcgacggtttcgcgcaacgcatcgcccgcgac
ttgacgccgcaagactggggcgacgtgttcgccgatgcgctcgcgcgcttcttcgattcg
ggcccggcgttcgccgacgcgctgtccggcgtgcgcgacgcgcttgacgcgatgctcgcc
gcgatggcggaaggcgcgggccgcgccgaattgccggccgccgtcgtgcgcgcgggcctc
gcggccgcgctcgacgatccggcgcgcggcggcgtgccgtggggcggcgtcacgttctcg
tcgctcacgagcctgcgcgggctgccgtatcgcatcgtgtgcctgatcgggatggacgac
ggcgtgctgccgagcctcgcgcgcgcggacgaattcgacctgatggcagtgttcgcgaag
ctcggcgaccgccagcggcgcgacgacgagcgcaatctgttcctcgacctgctgctcgcc
gcgcgcgatcgcctgctgatcgcgtacacgggccgcagcatccgcgacaacgcgccgttg
ccgcccgcggcgctcgtcgacgaactgctcgaccatctggcgacggtgtccgccgggccc
gacgcgtcacccgacgcggtcgacgccgcgcgccgcgcgttcgtgatcgagcatccgctg
caaccattctcggccgattacttcgcgccgggcggcgcgcttttcacgtacgacgcgtcg
cgtgcgacactcgcgcgcctgctcgccgaaggcgggcgggcgcaggcgctcccgttcttt
tcggaaccgctgcccgccgagccggcggagcccgtcgccttcgcggatttcgagcgcttc
tggcgccacccggcgcgctcgctgctgcgcgcgcggctcggcatcgtgctgtgggatgcg
caggcggagctcgtcgataccgagccgttcgagctcgattacgcgggcagcgacgcgctc
gccgggcgcgtgctcccgcttctgatcgagacggccgatgcgggcgcgttcgagcatgcg
ctgcgcgtcgccgacgcaagccccgaggtgcccggcggtgcgacgggcgcggtgcggcgc
gaccatgagctcgacgcgctcgcgcagctcgcgggcaacgtgcggcgcgcgctcgccgac
ggcgcggcgcgcgtgccgttcgcgctcgacgtcgcgcccgcgtggccggcggcgggcgac
gcgccgtggttcggcgagcacgacgccgcgcttgcgtcggccgcgacacgcgagccattg
cgcctgcacggcgcgctcgcgcgtctgacggcggcgggccaggtgatctaccgctatgcg
cggccgggtgcgcgcgactatctatcggcgtggctcgcgcatctcgtctattgcgcgatc
gatcccgccgggccccgccgtacgctgtggctcggctgcggcgacacgttcgaattcgcg
cccgtcgccgcgccgctcgagcagctcgcgccgctcgccgcgctgtttcgcgcgggacgc
cggatgccgctcgcgtttttcccgaggagcgcatgggccctcgtgtcggagagcgaatcg
aaggcggcgggtgtgtggatcaacgatcgcgtcgcgggcgaggccgacgatgcggcgctc
gcgctcgcgtggcgcggcgcgaatccttcgctcgacgagccgttcggcgcgctcgcgcat
ctcgtgttcgatccgctcgtcgagcatctgcggagggcgtcatga

DBGET integrated database retrieval system