KEGG   Burkholderia thailandensis 2003015869: DR62_4340
Entry
DR62_4340         CDS       T03763                                 

Name
(GenBank) hypothetical protein
Organism
btha  Burkholderia thailandensis 2003015869
SSDB
Motif
Pfam: DUF6277
Other DBs
NCBI-ProteinID: AIP66439
UniProt: A0A135HB79
Position
2:complement(1920596..1920955)
AA seq 119 aa
MIDPKEIFAACNNAHQYGQDASGSMAKPFMDSIPNLSTASSSNASNLIGNVQEVGSKMLE
HMSSIKSAVDKQVMIHQDNQQRQKTYDFNVDMRDLRPTNAVGFPEEMPSIFFAPFRTGK
NT seq 360 nt   +upstreamnt  +downstreamnt
atgattgatccgaaggaaatcttcgccgcatgcaacaacgcgcaccagtacgggcaggac
gcgagcggctcgatggccaagccgttcatggattcgatcccgaatctgtcgacggcgtcg
tcgagcaacgcgagcaacctgatcggcaacgtgcaggaggtcggctcgaagatgctcgag
cacatgtcgtcgatcaagtcggcggtcgacaagcaagtgatgatccatcaggacaaccag
cagcgtcagaagacctacgacttcaacgtcgacatgcgggacctgcgcccgaccaacgcg
gtcggtttcccggaggagatgccgtcgatcttcttcgcgccgttcaggaccggcaagtga

DBGET integrated database retrieval system