KEGG   Burkholderia thailandensis 2003015869: DR62_4843Help
Entry
DR62_4843         CDS       T03763                                 

Definition
(GenBank) amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
btha  Burkholderia thailandensis 2003015869
Pathway
btha00330  Arginine and proline metabolism
btha00360  Phenylalanine metabolism
btha00380  Tryptophan metabolism
btha00627  Aminobenzoate degradation
btha00643  Styrene degradation
btha01100  Metabolic pathways
btha01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:btha00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    DR62_4843
   00360 Phenylalanine metabolism
    DR62_4843
   00380 Tryptophan metabolism
    DR62_4843
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    DR62_4843
   00643 Styrene degradation
    DR62_4843
Enzymes [BR:btha01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     DR62_4843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AIP66017
Position
2:complement(2539786..2541351)
Genome map
AA seq 521 aa AA seqDB search
MKRRRFLHTLGALSSTQAMLASAPASAGPTAHDGRGGASARASQAVREALDRIARIDRDG
PRLNAIIELNPDAEAIAQALDAEQAAGAARGPLHGVTVALKDNIATGDRMSTTAGSLALD
GVRATRDAQLVAQLRRAGAVIVAKTNLSEWANFRSTRSTSGWSARGGLSRNPYALDRTTS
GSSSGSAVAVAAGLVAMAVGTETDGSIVSPAALNGCVGLKPTVGRVSRDGIVPLSHTQDT
AGPIARTVLDAARLLGALAGGDANDPAAASAPAPADYVAALDANALRGARIGIARAYFTG
HDEVDAQIERAIAQMQRLGAIVIDPVDLPKPDYEDDEKTVLLHEFKHGLPQWLRAFAPHA
RVSTLADVIAFNDAQRAREMPYFGQELLLAAQEAGGLDAAAYREALARCGRRARDEGLAR
VLREQRLDALVAPTEGTAWLIDLINGDSGGEGFSTPAAVAGFPHLTVPAGLVRGLPVGVS
FVGAPWSEARLLALGYAFEQATQWRREPRFVERSNVPAADG
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgacgtcgatttcttcacacgctcggcgcgctgagctcgacgcaggccatgctc
gcgagcgcgcccgcatcggctgggccgacggcgcacgacggccgcggcggcgcatcggca
cgcgcatcgcaggcggtgcgcgaggcgctcgatcgcatcgcgcggatcgatcgcgacggc
ccgcgcctgaacgcgatcatcgaattgaatccggatgccgaagcgatcgcgcaggcgctc
gacgccgagcaggcggcgggcgccgcgcgcggcccgctgcacggcgtgaccgtcgcgctg
aaggacaacatcgcgacgggcgaccggatgtcgacgacggccggctcgctcgcgctcgac
ggcgtgcgcgcgacgcgcgatgcgcagctcgtcgcgcagctgcggcgcgcgggcgcggtg
atcgtcgcgaagaccaacttgagcgaatgggcgaacttccgctcgacgcgctcgacgagc
ggctggagcgcgcgcggcgggctgtcgcgcaacccgtacgcgctcgaccggacgacgagc
gggtcgagctccggctcggcggttgcggtggcggcggggctcgtcgcgatggcggtcggc
accgagaccgacggttcgatcgtgtcgcccgccgcgctcaacggttgcgtcggcctgaag
ccgacggtcgggcgcgtgagccgcgacgggatcgtgccgctgtcgcacacgcaggacacg
gcggggccgatcgcgcgcacggttctcgacgcggcgcggctgctcggcgcgctcgcgggc
ggcgacgcgaacgatcccgcggcggcgagcgcgcccgcgcccgcggactacgtcgccgcg
ctcgacgcgaacgcgctgcgcggcgcgcgcatcggcatcgcgcgtgcatacttcaccggg
catgacgaggtcgacgcgcagatcgagcgcgcgatcgcccagatgcagcggctcggcgcg
atcgtgatcgacccggtcgatctgccgaagcccgactacgaggacgacgagaaaaccgtg
ctgctgcacgaattcaagcacggcttgccgcagtggctgcgcgcgttcgcgccgcacgcg
cgcgtgagcacgctcgcggacgtgatcgcgttcaacgatgcgcagcgcgcgcgggagatg
ccgtatttcgggcaggagttgctgctggccgcgcaggaggcgggcgggctcgacgccgcc
gcctatcgtgaagcgcttgcgcgctgcggccgccgcgctcgcgacgagggcctcgcgcgc
gtgctgcgcgagcagcggctcgacgcgctcgtcgcgccgaccgagggcaccgcgtggctg
atcgatctgatcaatggcgacagcggcggcgaaggcttctcgacgcccgccgcggtcgcc
ggcttcccgcatctgaccgtgccggccggccttgtgcgcggcttgccggttggcgtgtcg
ttcgtcggcgcgccgtggagcgaggcacggctgctcgcgctcggctacgcgttcgagcag
gcgacgcagtggcggcgcgagccgcggttcgtcgagcgatcgaacgtgccggcggccgac
gggtga

DBGET integrated database retrieval system