KEGG   Burkholderia thailandensis E254: BTN_1357Help
Entry
BTN_1357          CDS       T03380                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bthe  Burkholderia thailandensis E254
Pathway
bthe00071  Fatty acid degradation
bthe00072  Synthesis and degradation of ketone bodies
bthe00280  Valine, leucine and isoleucine degradation
bthe00310  Lysine degradation
bthe00362  Benzoate degradation
bthe00380  Tryptophan metabolism
bthe00620  Pyruvate metabolism
bthe00630  Glyoxylate and dicarboxylate metabolism
bthe00640  Propanoate metabolism
bthe00650  Butanoate metabolism
bthe00900  Terpenoid backbone biosynthesis
bthe01100  Metabolic pathways
bthe01110  Biosynthesis of secondary metabolites
bthe01120  Microbial metabolism in diverse environments
bthe01130  Biosynthesis of antibiotics
bthe01200  Carbon metabolism
bthe01212  Fatty acid metabolism
bthe02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bthe00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BTN_1357
   00630 Glyoxylate and dicarboxylate metabolism
    BTN_1357
   00640 Propanoate metabolism
    BTN_1357
   00650 Butanoate metabolism
    BTN_1357
  Lipid metabolism
   00071 Fatty acid degradation
    BTN_1357
   00072 Synthesis and degradation of ketone bodies
    BTN_1357
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BTN_1357
   00310 Lysine degradation
    BTN_1357
   00380 Tryptophan metabolism
    BTN_1357
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BTN_1357
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BTN_1357
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BTN_1357
Enzymes [BR:bthe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BTN_1357
Exosome [BR:bthe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BTN_1357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIT20128
Position
1:complement(1487018..1488211)
Genome map
AA seq 397 aa AA seqDB search
MTTVDQDPIVIASAARTPIAGFQGDFASLAAPQLGAVAIAAALERAGLKPEQIDEAVMGC
VLPAGQGQAPARQAALGAKLPLSVGCTTVNKMCGSGMRAAMFAHDMLIAGSVDVIVAGGM
ESMTNAPYLLPKARAGMRMGHGQVLDHMFLDGLEDAYDKGRLMGTFAEECAGEYAFSREA
QDAFAIESLARAKRANEDGSFAWEIASVTVAGKKGDTVVARDEQPFKANPEKIPTLKPAF
SKTGTVTAANSSSISDGAAALVMMRASTANRLGVTPLARVVGHSTFAQAPSKFTTAPVGA
IRRLFDKNGWRAAEVDLYEINEAFAVVTMAAMKEHGLPHDKVNVNGGACALGHPIGASGA
RILVTLIGALRARAAKRGVASLCIGGGEATAMGIELI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacgactgttgatcaggacccgatcgtcatcgcgtcggcggcgcgcacgccgatcgcg
ggctttcagggcgacttcgcgtcgctcgccgcgccgcagctgggcgcggtcgcgatcgcc
gcggcgctcgagcgcgcgggcttgaaaccggagcagatcgacgaggcggtgatgggctgc
gtgctgcccgcgggacagggacaggccccggcgcggcaggccgcgctcggcgcgaagctg
ccgctgtcggtcggctgcacgacggtcaacaagatgtgcggctcgggcatgcgcgcggcg
atgttcgcgcacgacatgctcatcgcgggctcggtcgacgtgatcgtcgcgggcggcatg
gaaagcatgacgaatgcgccgtacctgctgccgaaggcgcgcgcgggcatgcgcatgggc
cacggccaggtgctcgaccacatgttcctcgacggcctcgaggacgcctacgacaagggc
cgcctgatgggcacgttcgccgaggaatgcgcgggcgaatacgcgttctcgcgcgaggcg
caggacgcgttcgcgatcgaatcgctcgcgcgcgcgaagcgggcgaacgaggacggctcg
ttcgcgtgggaaatcgcgtccgtcacggtggccggcaagaagggcgacacggtggtcgcg
cgcgacgagcagccgttcaaggcgaaccccgagaagatcccgaccctcaagcccgcgttc
agcaagacgggcaccgtgaccgccgcgaattcgtcgtcgatctccgacggcgcggccgcg
ctcgtgatgatgcgcgcgtcgacggcgaacaggctgggcgtcacgccgctcgcgcgcgtc
gtcggccattcgacgttcgcgcaagcgccgtcgaagttcacgacggcgcccgtcggcgcg
atccggcgcctgttcgacaagaacggctggcgcgcggccgaggtcgacctctacgagatc
aacgaggcgttcgcggtcgtcacgatggcggcgatgaaggagcacggcctgccgcacgac
aaagtcaacgtcaacggcggcgcatgcgcgctcggccatccgatcggcgcgtcgggcgcc
cgcatcctcgtcacgctgatcggcgcgctgcgcgcgcgcgcggccaagcgcggcgtcgcg
agcctgtgcatcggcggcggcgaggcgaccgcgatgggcatcgagctgatctga

DBGET integrated database retrieval system