KEGG   Burkholderia thailandensis E254: BTN_1402Help
Entry
BTN_1402          CDS       T03380                                 

Definition
(GenBank) gamma-glutamyltranspeptidase family protein
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
bthe  Burkholderia thailandensis E254
Pathway
bthe00430  Taurine and hypotaurine metabolism
bthe00460  Cyanoamino acid metabolism
bthe00480  Glutathione metabolism
bthe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bthe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BTN_1402
   00460 Cyanoamino acid metabolism
    BTN_1402
   00480 Glutathione metabolism
    BTN_1402
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bthe01002]
    BTN_1402
Enzymes [BR:bthe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     BTN_1402
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     BTN_1402
Peptidases and inhibitors [BR:bthe01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   BTN_1402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept Glyco_transf_5
Motif
Other DBs
NCBI-ProteinID: AIT20204
Position
1:complement(1536480..1538369)
Genome map
AA seq 629 aa AA seqDB search
MTDRIRPRPSRSRAGAIAAAFFAVAAAGCANAPGPSAQNAAASASAASAASAASATPGAS
PSEPAELSSWVDKPGWTAQRDMIAAAHPLAAQAGQEMLKAGGTAVDAAIAAQMVLMLVEP
QASGIGGGAFLLHANGKTVEAYDGRETAPAAATDRLFYGADGKPLPRAAPGARTVGVPGV
LRMLELAHRAHGKLPWRRLFQPAIRLAEQGFPLGPRLAAALANDPSLASDPAARACFYDK
NGAPKPAGATLRNPQLAATLKLVAAHGANAFYTGAIARDIVAKVRQAPNPGVLSVQDLAR
YRAKVREPLCADYRKWIVCGMPPPSAGGLVVAQILGLLEAQPDWRQIGAQKPVRNATGVE
PTPFAAHQFSEAGRLAYADRAQYVADPDFVAPPGGSWTSLVERRYVAERARLIGDASAGT
ASAGSPSGLPPASAADRGAEPPSGSQITVVDRYGNAVSMTSTLDERFGSRLMVRGFLLNS
QLLDFSPVSAEHGKPVANRVQPGKRARSTLAPELVFEKGSQRLMMALGSAGGAFAANDVA
KTLVGMIDWGMTMQQAIALPNFGSRNGPTELEKGRVSDALAQALKERGHDVRVVELGSSL
QGIQRINVEGQSVWFGGSDPRSDGVVSGD
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccggattcgtccgcgcccgtcccgttcacgggccggcgcgatcgccgccgcc
tttttcgccgtcgccgccgccggatgcgcgaacgcgcccggcccgagcgcgcagaacgcc
gccgcatcggcgtcggcagcgtcggctgcctcggcggcttccgcgacgccaggcgcatcg
ccgtccgaaccggccgagctgtcgagctgggtcgacaagccgggctggaccgcgcagcgc
gacatgatcgcggccgcgcatccgctcgccgcgcaggccggccaggagatgctgaaggcg
ggcggcaccgccgtcgacgcggcgattgccgcgcagatggtgctgatgctcgtcgagccg
caggcgtcgggcatcggcggcggcgcgttcctgctgcacgcgaacggcaagacggtcgaa
gcgtacgacggccgcgagaccgcgcccgccgccgcgaccgaccggctcttctacggcgcc
gacggcaagccgctgccgcgcgctgcgcccggcgcgcgcacggtcggcgtgccgggcgtg
ctgcgcatgctcgagctcgcgcaccgcgcgcacggcaagctgccgtggcgacgcctgttc
cagcccgcgatccggctcgccgagcagggctttccgcttggccctcggctggcggcggcg
cttgcgaacgacccgtcgctcgcgagcgatccggccgcgcgcgcgtgcttctacgacaag
aacggcgcgccgaagcccgcgggcgcgacgctgaggaatccccagctcgcggcgacgctc
aagctcgtcgccgcgcacggcgcgaacgcgttctatacgggcgcgatcgcgcgcgacatc
gtcgcgaaagttcggcaggcgccgaatcccggcgtgctgagcgtgcaggacctcgcgcga
taccgcgcgaaagtgcgcgagccgctgtgcgccgactatcgcaaatggatcgtgtgcggg
atgccgccgccgtcggcgggcgggctcgtcgtcgcgcagatcctcggtctgctcgaggcg
cagccggactggcggcagatcggcgcgcagaagcccgtgcgcaatgcgacgggcgtcgag
ccgacgccgttcgccgcgcatcagttcagcgaggcgggccgtctcgcgtacgcggaccgc
gcgcagtacgtcgccgatcccgacttcgtcgcgccgccgggcggcagttggacgagcctc
gtcgagcggcgctacgtcgccgagcgcgcgcggctgatcggcgacgcgagcgcgggcacc
gcgagcgccggctcgccatccggcctgccgcctgcgtccgccgccgaccgcggcgcggaa
ccgccgtcgggatcgcagatcacggtcgtcgatcgctacggcaacgcggtatcgatgacg
tcgacgctcgacgagcgcttcggctcgcggctgatggtgcgcggcttcctgctcaacagc
cagttgctcgatttctcgcccgtgtcggccgagcacggcaagccggtcgcgaaccgcgtg
cagccgggcaagcgcgcacgctcgacgctcgcgcccgaactcgtgttcgagaaaggctcg
cagcggctgatgatggcgctcggctcggcgggcggcgcattcgccgcgaacgacgtcgcg
aagacgctcgtcgggatgatcgactggggcatgacgatgcagcaggcgatcgcgctgccg
aacttcggctcgcgcaacgggccgaccgagctcgagaaggggcgcgtatccgatgcgctt
gcccaagcgctgaaggaacgcgggcacgacgtgcgcgtcgtcgagctggggtcgagcctg
cagggaatccagcggatcaacgtcgaggggcagtcggtatggttcggcggctcggacccg
cgaagcgacggggtcgtctcgggggactga

DBGET integrated database retrieval system