KEGG   Burkholderia thailandensis E254: BTN_1850Help
Entry
BTN_1850          CDS       T03380                                 

Gene name
cobC
Definition
(GenBank) alpha-ribazole phosphatase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
bthe  Burkholderia thailandensis E254
Pathway
bthe00860  Porphyrin and chlorophyll metabolism
bthe01100  Metabolic pathways
Module
bthe_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:bthe00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BTN_1850 (cobC)
Enzymes [BR:bthe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     BTN_1850 (cobC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AIT19146
Position
1:2063516..2064106
Genome map
AA seq 196 aa AA seqDB search
MDVVLIRHPAVAVDAGVCYGSSDVPLAAGAAAGAAAILRRLSALGAAPAARASRVWSSPL
ARCANVARVLADDMRVPVEIDSRLREIDFGAWEMRSWDAIGCDALDRWSADLMHSREHGG
ESAAQFVARVRPALAALAASASASWVVTHAGVMRALASHALDVPLEALLARPIAMGGIVW
LRRDGDRDWRLAHWDG
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggatgtcgtcctgattcgccatccggccgtcgccgttgacgcgggcgtctgctacggc
agcagcgacgtgccgctcgcggcgggcgcggcggcgggcgccgccgccatcctgcggcgt
ttgagcgcgctcggcgccgcgcccgccgcgcgcgcgtcgcgcgtgtggtcgagcccgctc
gcgcgctgcgcgaacgtcgcgcgcgtgctggccgacgacatgcgcgtgccggtcgagatc
gattcgcgcttgcgcgaaatcgacttcggcgcgtgggagatgagaagctgggacgcgatc
ggctgcgacgcgctcgatcgatggagcgccgatctgatgcattcgcgcgagcacggcggc
gagagcgccgcgcagttcgtcgcgcgcgttcggccggcgctcgcggcgcttgccgcttcg
gcgagcgctagctgggtcgtcacgcatgcgggcgtgatgcgcgcgctggcctcgcatgcg
ctcgacgtgccgctcgaagcgttgctcgcgcggccgatcgcgatgggcggcatcgtgtgg
ttgcggcgcgacggcgatcgcgactggcggctcgcgcattgggacgggtga

DBGET integrated database retrieval system