KEGG   Burkholderia thailandensis E254: BTN_2616Help
Entry
BTN_2616          CDS       T03380                                 

Gene name
ccmA
Definition
(GenBank) heme ABC exporter, ATP-binding protein CcmA
  KO
K10441  ribose transport system ATP-binding protein [EC:3.6.3.17]
Organism
bthe  Burkholderia thailandensis E254
Pathway
bthe02010  ABC transporters
Module
bthe_M00212  Ribose transport system
Brite
KEGG Orthology (KO) [BR:bthe00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BTN_2616 (ccmA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bthe02000]
    BTN_2616 (ccmA)
Enzymes [BR:bthe01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.17  monosaccharide-transporting ATPase
     BTN_2616 (ccmA)
Transporters [BR:bthe02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Ribose transporter [MD:M00212]
    BTN_2616 (ccmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_29 TsaE AAA_23 AAA_13
Motif
Other DBs
NCBI-ProteinID: AIT20933
Position
1:2898143..2899732
Genome map
AA seq 529 aa AA seqDB search
MDSTDPDSTPGTSTMPAAPTLVVTGIGKTYAEPVLADVSLTLYPGEALALTGENGAGKST
LSKIVAGLVAPTTGAMRLAGAEYAPQSRAHAEALGVRMVMQELNLVPTLTVAENLFLDRL
PHRFGVIDRRRLAADARTAMARVGLDSLDPDTPVGALGIGHQQMVEIARSLAGDCRVLIL
DEPTAMLTAREVELLFDQIARLKADGVALVYISHRLEELARVAQRVAVLRDGRLVHVDRI
DAQPIDRLVALMAGREIAEQAVHGTRTPGAPRLKVERLSRGGAVRDVSFDVRSGEIFGVS
GLIGAGRTELLRLVYGADMADGGTVSVGDPPRPAAIRSPADAVRHGIALVSEDRKGEGLL
LSQSIAANLSLGQLARVARGGVVDGERENALAARQIDALRIRARGPAQPVSELSGGNQQK
VAIGRWLGRDMGVLLFDEPTRGIDVGAKFDIYALLDALAREGRAIVVVSSDLRELMLICD
RIGVMSAGRMHAVFERGAWTQDALLAAAFAGYARRDAALHPPGGARTAA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggattcgaccgacccagattcgacgcccggtacgtcgaccatgccggctgcgccgacg
ctcgtcgtgacgggcatcggcaagacctacgccgagcccgtgctcgccgacgtgtcgctc
acgctctatccgggcgaggcgctcgcgctgacgggcgagaacggcgcgggcaagagcacg
ctgtcgaagatcgtcgccgggctcgtcgcgccgacgacgggcgcgatgcggctggcgggc
gcggagtatgcgccgcaaagccgcgcgcacgcggaggcgctcggcgtgcggatggtgatg
caggagctcaacctcgtgccgacgctcaccgtcgccgagaacctgtttctcgaccgcctg
ccgcaccggttcggcgtgatcgaccgcaggcggctcgcggccgacgcgcgcacggcgatg
gcgcgcgtcgggctcgattcgctcgatcccgacacgcccgtcggcgcgctcggaatcggc
catcagcagatggtcgagatcgcgcgcagcctcgcgggcgactgccgcgtgctgatcctc
gacgagccgaccgcgatgctgaccgcgcgcgaggtcgagctgctgttcgaccagatcgcg
cggctgaaggccgacggcgtcgcgctcgtctacatctcgcaccggctcgaggagctcgcg
cgggtcgcgcagcgggtggcggtgttgcgcgacggccggctcgtgcacgtcgaccggatc
gacgcgcagccgatcgatcggctcgtcgcgctgatggccgggcgcgagatcgccgagcag
gcggtgcacggcacgcgcacgccgggcgcgcctcgcctgaaggtggagcggctctcgcgc
ggcggcgcggtgcgcgacgtgtcgttcgacgtgcgctcgggcgagatcttcggcgtttcc
gggctgatcggcgcggggcgcaccgagttgctgcggctcgtctacggcgcggacatggcg
gacggcggcaccgtgtcggtcggcgatccgccgcggcccgcggcgatccgctcgcccgcc
gacgcggtgcgccacggcatcgcgctcgtcagcgaagaccgcaagggcgaggggctgctg
ctgtcgcagtcgatcgcggcgaacctgtcgctcgggcagcttgcgcgcgtcgcgcgcggc
ggggtcgtcgacggcgagcgggaaaacgcgctcgccgcccggcagatcgacgcgctgcgc
atccgcgcgcgcggccccgcgcagccggtgtcggagctgtcgggcggcaatcagcagaag
gtcgcgatcggccgctggctcggccgcgacatgggcgtgctgctgttcgacgagccgacc
cgcgggatcgatgtcggcgcgaagttcgacatctatgcgctgctcgacgcgctcgcgcgc
gagggccgcgcgatcgtcgtcgtgtcgagcgacctgcgcgagctgatgctgatctgcgac
cggatcggcgtgatgtcggcggggcggatgcatgccgtgttcgagcgcggcgcgtggacg
caggacgcgctcctcgccgccgcgttcgccggctacgcgcgccgcgatgcggcgttgcac
ccgcccggcggcgcgcgaaccgccgcgtag

DBGET integrated database retrieval system