KEGG   Burkholderia thailandensis E254: BTN_2990Help
Entry
BTN_2990          CDS       T03380                                 

Gene name
ompR
Definition
(GenBank) transcriptional regulatory protein ompR
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
bthe  Burkholderia thailandensis E254
Pathway
bthe02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bthe00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BTN_2990 (ompR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bthe02022]
    BTN_2990 (ompR)
Two-component system [BR:bthe02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   BTN_2990 (ompR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C DUF43
Motif
Other DBs
NCBI-ProteinID: AIT19534
Position
1:3359719..3360444
Genome map
AA seq 241 aa AA seqDB search
METKNPSKILVVDDDPRLRDLLRRYLGEQGFNVYVAENATAMNKLWVRERFDLLVLDLML
PGEDGLSICRRLRGSNDRTPIIMLTAKGEDVDRIVGLEMGADDYLPKPFNPRELVARIHA
VLRRQAPAELPGAPSETTEVFEFGEFSLNLATRTLTKSGQEIPLTTGEFSVLKVFARHPR
QPLSREKLMELARGREYEVFDRSLDVQISRLRKLIEPDPGSPRFIQTVWGLGYVFIPDGA
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgaaaaacccctccaagattctcgtcgtcgacgacgacccgcgcctgcgcgat
ctgctgcgccgctatctcggcgagcagggcttcaacgtgtatgtcgcggagaacgcgacg
gcgatgaacaagctctgggtgcgcgagcgcttcgatctgctcgtgctcgacctgatgctg
ccgggtgaggatggcctgtcgatctgccggcgcctgcgcggcagcaacgaccgcacgccg
atcatcatgctcaccgcgaagggtgaggacgttgatcgcatcgtcggcctcgagatgggc
gccgacgactacctgccgaagccgttcaacccgcgcgagctcgtcgcgcgcatccacgcg
gtgctgcgccgccaggcccccgccgagctgccgggcgcgccctccgagaccaccgaggtg
ttcgagttcggcgaattctcgctgaacctcgcgacgcgcacgctgacgaaatccggccag
gagattccgctcacgacgggcgaattctcggtgctgaaggtgttcgcgcgccatccgcgc
cagccgctgtcgcgcgaaaagctgatggagctcgcgcgcggccgcgaatacgaagtgttc
gaccgcagcctcgatgtgcagatctcgcgcctgcgcaagctgatcgaacccgatccgggc
agccctcgcttcatccagacggtgtggggcctcggttacgtgttcatccccgacggcgcg
gcctga

DBGET integrated database retrieval system