KEGG   Burkholderia thailandensis E254: BTN_398Help
Entry
BTN_398           CDS       T03380                                 

Definition
(GenBank) carbon-nitrogen hydrolase family protein
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
bthe  Burkholderia thailandensis E254
Brite
KEGG Orthology (KO) [BR:bthe00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BTN_398
Enzymes [BR:bthe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     BTN_398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AIT19165
Position
1:444890..445717
Genome map
AA seq 275 aa AA seqDB search
MTDRHASASPFPVAALQMVSTPDRERNLAEAGRLIADAADAGARLVLLPEYFCFMGHQDT
DKLALAEAYRDGPIQRFLAERAKAHGVWVIGGTLPLSAPEPSRVLNTTLVFDPQGREAAR
YDKIHLFNFEKGDESFDEARTIRPGDAVRTFDAPFGRVGLSVCYDLRFPELYRRMGDCAM
IVVPSAFTYTTGRAHWETLLRARAVENQCYVLAAAQGGKHENGRRTWGHSMLVDPWGEVV
AVRDEGAGVVAGEIDPARIADVRQSLPAWRHRMLA
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcgccatgcttcagcctcgccgttcccggttgccgcgctgcagatggtcagc
acgcccgatcgcgagcgcaatctcgccgaagccggccggctgatcgccgacgcggcggat
gcgggcgcgcggctcgtgctgctgcccgagtacttctgcttcatgggccaccaggacacc
gacaagctcgcgctcgcggaagcctaccgggacggcccgatccagcgctttctcgccgag
cgcgcgaaggcgcacggcgtctgggtgatcggcggcacgctgccgctctcggcgcccgag
ccgtcgcgcgtgctgaacacgacgctcgtgttcgatccgcaaggccgcgaggccgcccgc
tacgacaagatccacctgttcaacttcgagaagggcgacgaatcgttcgacgaggcgcgc
acgatccgtccgggcgacgcggtgcgcacgttcgacgcgccgttcggccgggtcgggctg
tcggtctgctacgatctgcgctttccggagctgtaccggcggatgggcgactgcgcgatg
atcgtcgtgccgtcggcgttcacgtacacgacgggccgcgcgcactgggagacgctgctg
cgcgcgcgcgcggtcgagaaccagtgctacgtgctcgccgccgcgcaaggcggcaagcac
gagaacggccgccgcacgtggggccacagcatgctcgtcgacccgtggggcgaagtcgtc
gcggtgcgcgacgaaggcgcgggcgtcgtcgcgggcgaaatcgatcccgcgcggatcgcc
gacgtgcggcagagcctgcccgcgtggcggcaccgcatgctcgcgtga

DBGET integrated database retrieval system