KEGG   Burkholderia thailandensis E254: BTN_4467Help
Entry
BTN_4467          CDS       T03380                                 

Gene name
glcB
Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
bthe  Burkholderia thailandensis E254
Pathway
bthe00620  Pyruvate metabolism
bthe00630  Glyoxylate and dicarboxylate metabolism
bthe01100  Metabolic pathways
bthe01110  Biosynthesis of secondary metabolites
bthe01120  Microbial metabolism in diverse environments
bthe01200  Carbon metabolism
Module
bthe_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bthe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BTN_4467 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    BTN_4467 (glcB)
Enzymes [BR:bthe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BTN_4467 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AIT23251
Position
2:complement(1410227..1412401)
Genome map
AA seq 724 aa AA seqDB search
MIERHELRVDEGLARFIEHEAMPGTGVDAAAFWQGFAALVHDLAPRNRALLAERDRLQRE
LDGWHRAHPGPVSDPRGYRAFLERIGYLVPPPERVAAATENVDSEIASQAGPQLVVPLSN
ARYALNAANARWGSLYDALYGTDALPEDGGATRAGAYNPVRGQRVIDYARDFLDRAAPLL
HGSHRDALRYRVDEGRLVVDTRDGAKALARPGQFAGHQGDAGAPSAVLLKHHGLHIEIRI
DASTPIGQGDPAHVTDVVLEAAVSTIIDCEDSVAAVDADDKVQLYRNWLGLIQGTLSEVV
DKGGRTFTRRLNADRAYRAPDGSTLTLHGRSLLFVRNVGHLMTTNAVLDRDGNEIPEGML
DGVVTTLCAMHDLTSKRNSRTGSIYIVKPKMHGPAEVAFADALFARVEDLLGLPRHTIKM
GIMDEERRTSVNLSACIAAAAARVAFINTGFLDRTGDEMHSAMEAGPMYRKGDMKSSAWI
AAYERNNVLAGLAAGLRGRAQIGKGMWAMPDLMRAMLEQKIAHPRAGANTAWVPSPTAAT
LHALHYHEVDVQAIQQELETIDYARERDALLDGLLTIPVVERAGWSDDEIRAEVENNAQG
ILGYVVRWVEQGIGCSKVPDIHDVGLMEDRATLRISSQHIANWLHHGVVTRAFVDEVFAR
MARVVDAQNAGDPNYRPMAADPANSHAFGAARALVLEGREQPSGYTEPLLHRYRLAFKQR
LKAG
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaacgacatgaactccgggtcgacgaaggtctcgcccggttcatcgaacacgaa
gcgatgcccggcacgggcgtcgacgcggccgcgttctggcagggcttcgccgcgctggtg
cacgacctcgcgccgcgcaatcgcgcgctgctcgcggagcgcgaccggctgcagcgcgag
ctcgacggctggcaccgcgcgcatccggggccggtgagcgacccgcgcggctaccgggcg
ttcctcgagcggatcggctatctggtgccgccgcccgagcgcgtcgcggcggcgaccgag
aacgtcgacagcgagatcgcgtcgcaggcgggcccgcagctcgtcgtgccgctgtcgaac
gcgcgctatgcgctgaacgcggcgaatgcgcgctggggcagcctgtacgacgcgctgtac
ggcaccgacgcgctgcccgaagacggcggcgcgacgcgcgcgggcgcgtacaacccggtg
cgcggccagcgcgtgatcgactacgcgcgcgacttcctcgatcgcgcggcgccgctgctg
cacggctcgcatcgcgacgcgctgcgctatcgcgtcgacgaaggccggctcgtcgtcgac
acccgcgacggcgcgaaggcgctcgcgcgcccgggccagttcgccggccaccagggcgac
gcgggcgcgccgagcgccgtgctgctcaagcatcacgggctgcacatcgagattcggatc
gacgcgtcgacgccgatcggtcaaggcgatcccgcgcacgtgaccgacgtcgtgctcgaa
gcggcggtgagcacgatcatcgattgcgaggattcggtcgcggccgtcgacgcggacgac
aaggtccagctctaccgcaactggctcggcctgattcagggcacgctgagcgaagtggtg
gacaagggcgggcgcacgttcacgcgccggcttaacgcggaccgcgcgtatcgcgcgccc
gacggctcgacgctcacgctgcacggccgctcgctgctgttcgtgcgcaacgtcggccat
ctgatgacgacgaacgcggtgctcgatcgcgacggcaacgaaattcccgaaggcatgctc
gacggcgtcgtcacgacgctttgcgcgatgcacgatctgacgtcgaagcgcaattcgcgc
acgggctcgatctacatcgtgaagccgaagatgcacgggcccgccgaggttgcgttcgcg
gatgcgctgtttgcgcgcgtcgaggatctgctcgggctgccgcgtcacacgatcaagatg
gggatcatggacgaggagcgccgcacgagcgtgaatctgtcggcgtgcatcgcggcggcg
gcggcgcgcgtcgcgttcatcaacacgggctttctcgaccgcacgggcgacgaaatgcac
agtgcgatggaagcggggccgatgtaccgcaagggcgacatgaagtcgtccgcgtggatc
gccgcgtacgagcgcaacaacgtgctcgcggggctcgcggccgggctgcgcggccgcgcg
cagatcggcaaggggatgtgggcgatgccggacctgatgcgcgcgatgctcgagcagaag
atcgcgcatccgcgcgcgggcgcgaacaccgcgtgggtgccgtcgccgaccgcggcgacg
ctgcatgcgctgcattaccacgaagtcgacgtgcaggcgatccagcaggaactcgaaacg
atcgactacgcgcgcgagcgcgatgcgctgctcgacggcctgctgacgattcccgtcgtc
gagcgcgccggctggagcgacgacgagattcgcgccgaagtcgagaacaacgcgcaaggc
atccttggctacgtcgtgcgctgggtcgagcagggcatcggctgctcgaaggtgccggac
attcacgacgtgggcctgatggaggatcgcgcgacgctgcgcatctcgagtcagcacatc
gcgaactggctgcaccacggcgtcgtcacgcgcgcgttcgtcgacgaggtgttcgcgcgg
atggcgcgcgtcgtcgatgcgcagaacgcgggcgacccgaactatcggccgatggcggcc
gatccggcgaactcgcacgctttcggcgcggcgcgcgcgctcgtgctggaaggccgcgag
cagccgagcggctataccgagccgctgctgcatcgataccggctcgcgttcaagcagcgc
ctgaaagcgggttga

DBGET integrated database retrieval system