KEGG   Burkholderia thailandensis E254: BTN_634Help
Entry
BTN_634           CDS       T03380                                 

Definition
(GenBank) polyprenyl P-hydroxybenzoate and phenylacrylic acid decarboxylase family protein
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
bthe  Burkholderia thailandensis E254
Pathway
bthe00130  Ubiquinone and other terpenoid-quinone biosynthesis
bthe00627  Aminobenzoate degradation
bthe01100  Metabolic pathways
bthe01110  Biosynthesis of secondary metabolites
bthe01120  Microbial metabolism in diverse environments
bthe01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bthe00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    BTN_634
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BTN_634
Enzymes [BR:bthe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     BTN_634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: AIT20246
Position
1:697970..698566
Genome map
AA seq 198 aa AA seqDB search
MEPRPAPPRRLIVAITGATGAIYGVRMLDMLRASGGVETHLLISSAGWLNIQHELQLSKD
DVLARADVVHSVRDVGASIASGSFATDGMIVAPCSMRTLASIAHGLSDNLITRAADVALK
ERRRLVLLVRETPFNLVHLRNMTAVTEMGGVIFPPLPAFYAMPKTIGEMVDHTVARVLDM
FALGVPRTAPWQGLREHG
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggagccccgtccggcgccgccgcggcgcctgatcgtcgcaatcacgggcgccaccggc
gcgatctacggcgtgcgcatgctcgacatgctgcgcgcgtcgggcggcgtcgaaacgcac
ctgctgatctcgagcgccggctggctcaacatccagcacgaactgcagttgtcgaaggac
gacgtgctcgcacgcgccgacgtcgtccattcggtgcgcgacgtcggcgcgagcatcgcg
tccggctcgttcgcgaccgacggcatgatcgtcgcgccgtgctcgatgaggacgctcgcg
agcatcgcgcacgggctgtccgacaatctcatcacccgcgccgccgacgtcgcgctgaag
gagcgccgccggctcgtgctgctcgtgcgcgagacgccgttcaacctcgtgcatctgcgc
aacatgacggccgtcaccgagatgggcggcgtgatcttcccgccgctgcccgcgttctac
gcaatgccgaagacgatcggcgagatggtggaccatacggtcgcgcgcgtgctcgacatg
ttcgcgctcggcgtgccgcgcaccgcgccgtggcaggggctgcgcgagcacggctga

DBGET integrated database retrieval system