KEGG   Burkholderia thailandensis E254: BTN_85Help
Entry
BTN_85            CDS       T03380                                 

Gene name
ubiG
Definition
(GenBank) 3-demethylubiquinone-9 3-O-methyltransferase
  KO
K00568  2-polyprenyl-6-hydroxyphenyl methylase / 3-demethylubiquinone-9 3-methyltransferase [EC:2.1.1.222 2.1.1.64]
Organism
bthe  Burkholderia thailandensis E254
Pathway
bthe00130  Ubiquinone and other terpenoid-quinone biosynthesis
bthe01100  Metabolic pathways
bthe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bthe00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    BTN_85 (ubiG)
Enzymes [BR:bthe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.64  3-demethylubiquinol 3-O-methyltransferase
     BTN_85 (ubiG)
    2.1.1.222  2-polyprenyl-6-hydroxyphenol methylase
     BTN_85 (ubiG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_11 Methyltransf_25 Methyltransf_31 Methyltransf_12 PrmA CMAS MTS Ubie_methyltran Methyltransf_9 NodS MetW TPMT Methyltransf_32 Methyltransf_18 TehB AdoMet_MTase
Motif
Other DBs
NCBI-ProteinID: AIT20917
Position
1:89128..89826
Genome map
AA seq 232 aa AA seqDB search
MTNADPHELQKFSDLAHKWWDPNAEFKPLHDLNPIRLNWIDAHAHLPGKRVVDIGCGGGI
LSESMASLGAQVKGIDLATEALGVADLHSLESGVSVDYEAIAAEALAAREPGAYDVVTCM
EMLEHVPSPANIVAACATLVKPGGWVFFSTLNRNLKSYLLAVIGAEYIAQMLPKGTHDYA
RFIRPSELAHFVRAAGLQLVEIKGITYHPLAKRFALSNDTDVNYLVACRRSV
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacgccgatccgcacgaactccagaaattcagcgacctcgctcacaaatggtgg
gatccgaacgccgaattcaagccgctgcacgatctcaatccgattcgcctgaactggatc
gacgcgcacgcgcacctgcccggcaagcgcgtggtcgacatcggctgcggcggcggcatc
ctgtcggaatcgatggcgtcgctcggcgcgcaggtcaagggcatcgatcttgcgacggaa
gcgctcggcgtcgccgatctgcacagcctcgaaagcggcgtgagcgtcgattacgaggcg
atcgcggctgaagcgctcgccgcacgcgagccgggcgcatacgacgtcgtcacctgcatg
gagatgctcgagcatgtgccgtcgcccgcgaacatcgtcgccgcgtgcgcgacgctcgtg
aagccgggcggctgggtgttcttctcgacgctgaaccgcaacctgaagtcttacctgctc
gccgtgatcggcgccgaatacatcgcgcagatgctgccgaagggcacgcacgactatgcg
cgcttcatccgcccgtcggagctcgctcacttcgtgcgcgcggccggcctgcaactcgtc
gagatcaagggcatcacctaccatccgctcgcaaagcgcttcgcgctgtcgaacgatacc
gacgtcaactatctcgtcgcatgccgccgcagcgtctga

DBGET integrated database retrieval system