KEGG   Bacillus thuringiensis serovar kurstaki HD-1: BTK_02375Help
Entry
BTK_02375         CDS       T03473                                 

Definition
(GenBank) L-fuculose phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bthi  Bacillus thuringiensis serovar kurstaki HD-1
Pathway
bthi00051  Fructose and mannose metabolism
bthi01100  Metabolic pathways
bthi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bthi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BTK_02375
Enzymes [BR:bthi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BTK_02375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AIE31601
Structure
PDB: 

Position
463870..464511
Genome map
AA seq 213 aa AA seqDB search
MLLQKEREEIVAYGKKMISSGLTKGTGGNISIFNREQGLVAISPSGLEYYETKPEDVVIL
NLDGEVIEGERKPSSELDMHLIYYRKREDINALVHTHSPYAKTIASLGWELPAVSYLIAF
AGPNVRCAPYETFGTKQLADAAFEGMIDRRAVLLANHGLIAGANNIKMAFTVAEEIEFCA
QIYYQTKSIGEPKLLPEDEMENLAKKFEGYGQQ
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgttattacaaaaagaaagagaagaaattgtagcgtatggaaagaaaatgatttctagt
ggtttaacaaaggggacgggtggtaatattagtatctttaatcgtgaacaaggtcttgtt
gcgattagcccaagtggtttagagtactatgaaacaaagcctgaagatgtagttatatta
aacctagatggtgaagtaatagaaggagagagaaaaccatcaagtgaattagatatgcac
cttatttactataggaagcgtgaagatataaatgcgcttgtgcatacacattctccttac
gcgaagacgattgcgtcattaggatgggagcttccggctgtgtcatatttaattgctttt
gcaggtccgaatgtccgctgtgcgccgtatgaaacatttggtacgaagcaattagcggat
gctgcttttgaaggcatgattgatcgtcgtgctgtgctacttgcaaatcacggtttaatt
gctggtgcaaataatataaaaatggcatttactgttgcagaagagattgagttttgtgct
caaatttattatcaaacgaaaagcattggggaaccaaagctattgccagaagatgagatg
gagaatttggcgaagaagtttgaagggtatgggcaacagtag

DBGET integrated database retrieval system