KEGG   Bacillus thuringiensis serovar kurstaki HD-1: BTK_08195Help
Entry
BTK_08195         CDS       T03473                                 

Definition
(GenBank) gentamicin resistance protein
  KO
K17910  aminoglycoside 2''-phosphotransferase [EC:2.7.1.190]
Organism
bthi  Bacillus thuringiensis serovar kurstaki HD-1
Brite
KEGG Orthology (KO) [BR:bthi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:bthi01504]
    BTK_08195
Enzymes [BR:bthi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.190  aminoglycoside 2''-phosphotransferase
     BTK_08195
Antimicrobial resistance genes [BR:bthi01504]
 Gene variants
  Aminoglycoside resistance genes
   O-Phosphotransferases
    BTK_08195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APH DUF1679
Motif
Other DBs
NCBI-ProteinID: AIE32734
Position
complement(1565316..1566218)
Genome map
AA seq 300 aa AA seqDB search
MDSYKHYIKEALPNLSIHSYKQNEEGWDNVAVIVNDELLFRFPRKQEYAMRIPLEKELCA
ILTQSLQEIEVPQYHLIYKNESDEVPLCSYYTLIHGEPLKTDTVATLEDPELKAIITQLA
TFLAVLHSIPLHQVTTLCFPIEKTCTYWKELQTKLNQYLTTSLTSLQKLALNRLFENFFA
CLAISTFQNTIIHTDFTHHHILFNKHNKSISGVIDFGDAQIGDPAFDFAGLYYDFGHEFT
TSVYEQYSTLISHHDPLLIHRITIFYQYSPLLHNIIYNFESENKLEFITGTEQLKTILQG
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggactcttacaaacattatataaaagaagctttgcctaatctttctatacattcatat
aaacaaaatgaagaaggatgggataatgtagcagttatagtaaatgatgagctattgttt
cgtttcccgcgaaaacaggaatatgcgatgcgaattccgttagaaaaagaactatgcgca
attctcactcaatcactacaagaaatcgaagttccacaatatcacctaatttataaaaat
gaatctgatgaggttcctctttgtagttactatactctcattcatggtgaaccattaaaa
acagacacagttgccacgctggaggatccagagctgaaagcaattattacacaattagct
actttccttgcggtactacatagcattcctttacaccaagttacaacgctatgtttccct
attgaaaaaacatgtacctactggaaagagctacaaacaaaattaaaccaatatctcact
actagccttacttcattacagaaactagccttaaatcgcttatttgaaaatttctttgca
tgtttagctatatccacttttcaaaacacaatcattcacactgattttactcatcatcac
attttatttaacaagcataacaaaagtatttcaggtgttatcgattttggtgatgcgcaa
attggcgatcctgcttttgattttgcaggactatattatgatttcggacatgagtttact
acatctgtatatgaacagtacagtacacttatttctcatcatgatccattactcattcat
cgcattactatcttctatcaatacagtcctttactacataatattatttataactttgag
tcagagaataaactcgaattcattacaggcacagaacagctaaaaacgatattacaggga
tga

DBGET integrated database retrieval system