KEGG   Bacillus thuringiensis serovar kurstaki HD-1: BTK_11720Help
Entry
BTK_11720         CDS       T03473                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bthi  Bacillus thuringiensis serovar kurstaki HD-1
Pathway
bthi00480  Glutathione metabolism
bthi00590  Arachidonic acid metabolism
bthi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bthi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    BTK_11720
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BTK_11720
Enzymes [BR:bthi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BTK_11720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AIE33429
Position
2233936..2234418
Genome map
AA seq 160 aa AA seqDB search
MTVYDFSAKTITGEEKSLKDYEGKALLIVNVASKCGFTPQYKGLQEVYDKYKDQGLEILG
FPCNQFGGQEPGTEADITSFCELNYGVNFPMFAKVDVKGDKAHPLYTYMTEQAPGLLGMK
AVKWNFTKFLIGKDGKVVGRFAPQTKPVDLEVEIEKVLGE
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacagtttatgatttttcagctaaaacaattaccggtgaagaaaaatcgttaaaagat
tacgaaggaaaagcacttcttattgtaaatgtagctagtaaatgtggtttcacaccgcaa
tataaaggattacaagaggtgtatgataaatataaagaccaaggacttgaaatactcgga
ttcccttgtaaccaattcggaggacaagaaccaggtacagaagcggatattactagtttt
tgtgaattaaactacggtgtaaacttcccaatgtttgcaaaggttgatgtgaaaggtgat
aaggctcatcctttatatacatacatgacagaacaagcaccaggtttactcggtatgaaa
gcagtgaaatggaattttacgaagtttttaatcggaaaagacgggaaagtagtagggcgt
tttgcgccgcagacgaagccggtagatttagaggttgagattgagaaggtacttggagaa
taa

DBGET integrated database retrieval system