KEGG   Bacillus thuringiensis serovar kurstaki HD-1: BTK_24340Help
Entry
BTK_24340         CDS       T03473                                 

Definition
(GenBank) acetate kinase A/propionate kinase 2
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
bthi  Bacillus thuringiensis serovar kurstaki HD-1
Pathway
bthi00430  Taurine and hypotaurine metabolism
bthi00620  Pyruvate metabolism
bthi00640  Propanoate metabolism
bthi00680  Methane metabolism
bthi01100  Metabolic pathways
bthi01120  Microbial metabolism in diverse environments
bthi01200  Carbon metabolism
Module
bthi_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:bthi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BTK_24340
   00640 Propanoate metabolism
    BTK_24340
  09102 Energy metabolism
   00680 Methane metabolism
    BTK_24340
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BTK_24340
Enzymes [BR:bthi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     BTK_24340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AIE35906
Position
complement(4718397..4719590)
Genome map
AA seq 397 aa AA seqDB search
MSKIIAINAGSSSLKFQLFEMPSETVLTKGLVERIGLEDSIFTITVDGEKQKEITNIPDH
AVAVNMLLKKLTENGIVKSLDEIGGIGHRVVHGGEKFADSVLITDEVLADIEELSDLAPL
HNPANVVGIKAFQEVLPNVPAVAVFDTAFHQTMPESAFLYSLPYEYYEKFGIRKYGFHGT
SHKYVTERAAELLGRPIESLSLLSCHLGNGASIAAVEGGKSIDTSMGFTPLAGVTMGTRS
GNLDPALIPYIMEKTGQTVEEVVNVLNKKSGMLGLTGYSSDLRDIIAKEEEGDRRAKVAL
DVFVSRIHKYIGSYTARMKGVDAIIFTAGVGENSAIIRERVLEGLEYMGVYFDAKRNNVF
GEEAFISFPHSPVKIIVIPTDEEVMIARDVLRLGDIG
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaatcatcgcgattaacgcaggaagctcttccttaaaattccaattatttgaa
atgccaagtgaaacagtattaacaaaaggtttagtagaacgtatcggtttagaagatagt
atcttcactattactgtagatggcgaaaaacaaaaagaaattacaaacattccagatcac
gcagtagcagttaatatgcttcttaaaaagttaactgaaaacggaatcgttaaatctcta
gatgagattggcggtatcggtcaccgtgttgttcacggcggcgaaaaatttgctgactct
gttttaattactgatgaagtattagctgatatcgaagaattaagcgatttagcaccactt
cataacccagcaaacgttgttggtattaaagcattccaagaagtattaccaaacgtacca
gcagtagcagtattcgatacagcattccaccaaacaatgccggaatctgcattcctatac
agcttaccatatgagtactatgaaaaattcggcatccgtaaatacggtttccacggaact
tctcataaatatgtaactgagcgtgcggctgaattattaggtcgtccaattgaaagctta
agcttactttcttgtcacttaggtaacggtgcaagtatcgcagcagtagaaggcggtaaa
tctattgatacttctatgggcttcactccacttgctggtgtaacaatgggtacacgttct
ggtaaccttgaccctgcgttaattccatacatcatggaaaaaacaggccaaacagtagaa
gaagtagttaacgtattaaacaagaagagtggtatgttaggtcttactggttactctagt
gacctacgtgacatcattgcgaaagaagaagaaggcgaccgccgtgcgaaagtagcactt
gatgtattcgtaagccgtatccacaaatacatcggttcttacactgctcgtatgaaaggt
gtagacgcaatcatcttcacagctggtgtaggtgaaaacagtgcgattattcgtgagcgc
gtattagaaggccttgagtacatgggcgtatacttcgatgcaaaacgtaataacgtattc
ggtgaagaagcattcatcagcttcccacactctccagtaaaaattatcgtaattccaact
gacgaagaagttatgattgctcgtgacgtactacgtcttggagatattggttaa

DBGET integrated database retrieval system