KEGG   Bacillus thuringiensis serovar kurstaki HD-1: BTK_28345Help
Entry
BTK_28345         CDS       T03473                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bthi  Bacillus thuringiensis serovar kurstaki HD-1
Pathway
bthi00071  Fatty acid degradation
bthi00072  Synthesis and degradation of ketone bodies
bthi00280  Valine, leucine and isoleucine degradation
bthi00310  Lysine degradation
bthi00362  Benzoate degradation
bthi00380  Tryptophan metabolism
bthi00620  Pyruvate metabolism
bthi00630  Glyoxylate and dicarboxylate metabolism
bthi00640  Propanoate metabolism
bthi00650  Butanoate metabolism
bthi00900  Terpenoid backbone biosynthesis
bthi01100  Metabolic pathways
bthi01110  Biosynthesis of secondary metabolites
bthi01120  Microbial metabolism in diverse environments
bthi01130  Biosynthesis of antibiotics
bthi01200  Carbon metabolism
bthi01212  Fatty acid metabolism
bthi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bthi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BTK_28345
   00630 Glyoxylate and dicarboxylate metabolism
    BTK_28345
   00640 Propanoate metabolism
    BTK_28345
   00650 Butanoate metabolism
    BTK_28345
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BTK_28345
   00072 Synthesis and degradation of ketone bodies
    BTK_28345
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BTK_28345
   00310 Lysine degradation
    BTK_28345
   00380 Tryptophan metabolism
    BTK_28345
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BTK_28345
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BTK_28345
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BTK_28345
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bthi04147]
    BTK_28345
Enzymes [BR:bthi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BTK_28345
Exosome [BR:bthi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BTK_28345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AIE36660
Position
complement(5458977..5460158)
Genome map
AA seq 393 aa AA seqDB search
MSKTVILSAARTPVGKFGGSLKDVKATELGGIAIKAALERANVAASDVEEVIFGTVIQGG
QGQIPSRQAARAAGIPWEVQTETVNKVCASGLRAVTLADQIIRTGDQSLIVAGGMESMSN
SPYILRGARWGYRMGNNEVVDLNVADGLTCAFSGTHMGVYGGEVAKEDGISREAQDEWAY
RSHQRAVSAHKEGRFEEEIVPVTIPQRKGDPIVVAKDEAPREDTTIEKLAKLKPVFDKTA
TVTAGNAPGLNDGGAALVLMSEDRAKQEGRKPLATILAHTAIAVESKDFPRTPGYAINAL
LEKTGKKIEDIDLFEINEAFAAVAIASTEIAGIDPEKLNVNGGAVAMGHPIGASGARIIV
TLIHALKQRGGGIGIASICSGGGQGDAVMIEVH
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaacagttattttaagtgctgcaagaacaccagttggaaaatttggaggatct
ttaaaagatgtaaaagcgacggaacttggaggaattgcaattaaagcagcgcttgaaaga
gcaaatgttgcggctagtgatgttgaagaagttatatttggaacggttattcaaggtgga
caggggcaaattccatcgcgccaagctgcaagggccgctggaatcccatgggaagtgcag
acggaaacagtgaataaagtttgtgcatcagggcttcgtgcggttacgttggcggatcag
attattcgtactggcgatcaatcactaattgtagctggcggtatggagtcgatgagtaac
agtccttacattttacgcggagcaagatggggatacagaatgggcaataacgaagttgtt
gatttaaacgttgctgacggtttaacatgtgcattttcaggtacacacatgggcgtttat
ggcggagaagttgcgaaagaagatggaatttctcgcgaagcgcaagatgaatgggcatat
cgtagccatcagcgtgcggtttcagcgcataaagaagggcgttttgaagaggaaatcgtg
ccagtaacgattccgcaaagaaaaggcgatcctattgtcgttgcaaaggatgaggcgcca
cgtgaagatacaacgattgaaaagttagcaaagttaaaacctgtatttgataagacagcg
acggtgacagctggtaatgcgccgggactaaatgatggtggtgccgcacttgtattaatg
agcgaagacagagcgaagcaagaaggaagaaagccattagcgacaattttggcgcataca
gcaattgcagtggaatctaaagatttcccaagaacgccaggttatgcaattaacgcattg
cttgaaaaaacaggcaagaaaattgaagacatcgatttattcgagattaatgaagcattt
gcagcggtagcaattgcaagtacagaaatcgcaggaattgatccggaaaaattgaatgta
aatggcggcgcggtagcgatgggacatccaattggagcaagcggagcgcgcattatcgtt
acactaatccatgcacttaagcagcgcggcggcggaattggaattgcttcgatttgtagc
ggtggcggtcaaggggacgcagtgatgattgaagtccactaa

DBGET integrated database retrieval system