KEGG   Bacillus thuringiensis serovar kurstaki HD-1: BTK_28440Help
Entry
BTK_28440         CDS       T03473                                 

Definition
(GenBank) aminopeptidase
  KO
K19701  aminopeptidase YwaD [EC:3.4.11.6 3.4.11.10]
Organism
bthi  Bacillus thuringiensis serovar kurstaki HD-1
Brite
KEGG Orthology (KO) [BR:bthi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bthi01002]
    BTK_28440
Enzymes [BR:bthi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.6  aminopeptidase B
     BTK_28440
    3.4.11.10  bacterial leucyl aminopeptidase
     BTK_28440
Peptidases [BR:bthi01002]
 Metallo Peptidases
  Family M28: aminopeptidase Y family
   BTK_28440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M28 PA Peptidase_M20 Peptidase_M42
Motif
Other DBs
NCBI-ProteinID: AIE36679
Position
5489094..5490494
Genome map
AA seq 466 aa AA seqDB search
MRKLLKQKIVSSLLAVSLAVSLAPIGQAKADSTSEVTQTPSITKQIDPNRAIEHVRFLSE
TIGPRPGGTKSEEWASRYIGMQLKSMGYDVEYQPFQVPDQYVGFIESPLSTKRNWQAGAA
PNALISTEAVTAPLIFVQGGTKLEDIPNEVNGKIVLFERGTTVTDYNKQVENAVSKGAKG
VLLYSLIGGRGNYGQTFNPHLMKKQSIPVFGLAYAQGNAFKEEIAKKGTTILSLKARHES
KLTSLNVIAKKKPKKSTGNEKAVVVSSHYDSVVGAPGANDNASGTGLVLELARAFQNVET
DKEIRFITFGSEETGLLGSDYYVNSLSQKERDRILGVFNADMVATNYDKAKNLYAMTSDG
STNFVTDAALQAGKQLNNNLILQGKFGSSDHVPFAEAGIPAALFIWMGVDSWNPLIYHIE
KVYHTPQDNVLENISPERMRMALDVIGTGVYNSLQKPVPQTEQKAA
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaattattgaaacaaaaaatagtaagctctttgcttgctgtatcacttgctgtt
agcttagctccaattgggcaagcaaaagcggattccacgtcagaggttacacaaactcca
tctattacaaaacagattgatccaaaccgcgcgattgaacatgttcgtttcttatctgaa
acaattggtcctcgccccggtggaacaaaatccgaagaatgggcttctcgttacattggt
atgcagcttaaatcaatgggctatgacgtagaatatcaaccatttcaggtgcccgatcaa
tacgttggattcattgaatcacccctatcaacaaaacgtaattggcaagctggtgccgct
cctaatgcactaatttctacagaagctgttacagctccccttatctttgttcaaggtggg
acaaaattagaagatattccaaatgaagtaaacggtaaaattgttttatttgaaagagga
acgacagttaccgactataataaacaagttgaaaatgctgttagcaaaggtgcaaaaggt
gttcttttatacagtttaattggcggacgcggaaattatggacaaaccttcaatccccac
ctaatgaaaaagcaatctatccctgtctttggtcttgcttatgcgcaaggaaatgcattt
aaagaagaaatcgctaaaaaggggacaacaattctttccctaaaagcgagacatgaatct
aaattaacatctctaaatgttatcgccaaaaagaaaccaaaaaagagtacaggtaatgaa
aaagcagtcgttgtaagctcgcactatgatagtgttgtcggagcacctggcgcaaatgat
aatgcttctggaactggattagtattagaactagctcgtgcttttcaaaatgtagaaact
gataaagaaattcgctttattacctttggttctgaagaaactggattacttggttcggat
tattacgtgaatagtctatcccaaaaagaacgcgaccgtattttaggtgtctttaacgcc
gacatggttgcaacaaattatgataaagcaaagaatttatatgctatgacatctgatggc
tctacaaactttgtaacagacgctgccttgcaagcaggtaaacaactaaataataacctc
atcctacaaggtaaattcggttctagtgatcatgttccatttgctgaagctggtattcct
gctgctctattcatttggatgggtgtcgatagttggaatccattaatctatcatattgag
aaggtataccatacacctcaagataacgtattagaaaacatttcacctgaacgaatgaga
atggcattagacgttatcggaacaggagtttataactcgcttcaaaaacctgttcctcaa
actgaacagaaagctgcttaa

DBGET integrated database retrieval system