KEGG   Bacillus thuringiensis serovar kurstaki HD-1: BTK_28585Help
Entry
BTK_28585         CDS       T03473                                 

Gene name
eutD
Definition
(GenBank) phosphotransacetylase
  KO
K00625  phosphate acetyltransferase [EC:2.3.1.8]
Organism
bthi  Bacillus thuringiensis serovar kurstaki HD-1
Pathway
bthi00430  Taurine and hypotaurine metabolism
bthi00620  Pyruvate metabolism
bthi00640  Propanoate metabolism
bthi00680  Methane metabolism
bthi01100  Metabolic pathways
bthi01120  Microbial metabolism in diverse environments
bthi01200  Carbon metabolism
Module
bthi_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:bthi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BTK_28585 (eutD)
   00640 Propanoate metabolism
    BTK_28585 (eutD)
  09102 Energy metabolism
   00680 Methane metabolism
    BTK_28585 (eutD)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BTK_28585 (eutD)
Enzymes [BR:bthi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.8  phosphate acetyltransferase
     BTK_28585 (eutD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB
Motif
Other DBs
NCBI-ProteinID: AIE36708
Position
complement(5515979..5516950)
Genome map
AA seq 323 aa AA seqDB search
MSNLFTTVKEKVQGKGISIVLPEGTDERILGAAERLAKEELVKPILVGNREEISAKAASM
NLTLAGVDIYDPATYEEMDAMVASFVERRKGKATEEDARKILKDENYFGTMLVYMGKAHG
LVSGAAHSTADTVRPALQIIKTKPGVTKTSGVFIMVREEEKYVFADCAINIAPNSQDLAE
IGIESAKTAELFGIDPRVAMLSFSTKGSAKSPETEKVVEATRIAKEMAPELTLDGEFQFD
AAFVPSVAEKKAPGSTIKGDANVFVFPSLEAGNIGYKIAQRLGNFEAVGPILQGLNMPVN
DLSRGCNEEEVYKLALITAAQAL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaacttatttacaacagtaaaagaaaaagttcaaggaaaaggcatttctatcgta
cttcctgaaggaactgatgaaagaattttaggcgctgcagagcgtttagcaaaagaagag
ttagtaaaaccaatcttagttggtaatagagaagaaattagcgcaaaagctgctagcatg
aatttaacattagcaggcgttgatatttacgacccagctacatacgaagaaatggatgcg
atggtagcatctttcgttgaacgccgtaaaggtaaagcaactgaagaagacgctcgcaaa
atccttaaagacgaaaactacttcggtacaatgcttgtatacatgggcaaagcacacggt
ctagtaagtggtgcagctcactctacagctgatacagttcgtccagcacttcaaattatt
aaaacaaaaccaggtgttacaaaaacttctggcgtattcatcatggtacgtgaagaagag
aaatatgtattcgctgattgcgcaattaacattgcaccaaacagccaagatttagctgaa
atcggtatcgaaagtgcgaaaactgctgagttattcggcattgatccacgcgttgctatg
ttaagcttctctacaaaaggttctgcgaaatctccagaaacagaaaaagttgtagaagca
actcgcattgcaaaagaaatggctcctgagttaactttagatggagaattccaattcgat
gctgcattcgtaccatctgtagctgagaaaaaagctccaggttctacaattaaaggtgat
gctaacgtattcgtattcccaagcttagaagctggtaatatcggctacaaaatcgctcaa
cgtttaggtaacttcgaagcagtaggaccaatcttgcaaggcttaaacatgcctgtaaat
gacctatctcgtggatgtaacgaagaagaagtgtacaagttagcattaattacagcagct
caagcactttaa

DBGET integrated database retrieval system