KEGG   Burkholderia thailandensis 2002721643: BG87_2002Help
Entry
BG87_2002         CDS       T03882                                 

Definition
(GenBank) hypothetical protein
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
bthl  Burkholderia thailandensis 2002721643
Pathway
bthl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bthl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BG87_2002
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bthl02022]
    BG87_2002
Two-component system [BR:bthl02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   BG87_2002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C DUF43
Motif
Other DBs
NCBI-ProteinID: AJY00392
Position
I:complement(2226187..2226912)
Genome map
AA seq 241 aa AA seqDB search
METKNPSKILVVDDDPRLRDLLRRYLGEQGFNVYVAENATAMNKLWVRERFDLLVLDLML
PGEDGLSICRRLRGSNDRTPIIMLTAKGEDVDRIVGLEMGADDYLPKPFNPRELVARIHA
VLRRQAPAELPGAPSETTEVFEFGEFSLNLATRTLTKSGQEIPLTTGEFSVLKVFARHPR
QPLSREKLMELARGREYEVFDRSLDVQISRLRKLIEPDPGSPRFIQTVWGLGYVFIPDGA
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgaaaaacccctccaagattctcgtcgtcgacgacgacccgcgcctgcgcgat
ctgctgcgccgctatctcggcgagcagggcttcaacgtgtatgtcgcggagaacgcgacg
gcgatgaacaagctctgggtgcgcgagcgcttcgatctgctcgtgctcgacctgatgctg
ccgggtgaggatggcctgtcgatctgccggcgcctgcgcggcagcaacgaccgcacgccg
atcatcatgctcaccgcgaagggtgaggacgttgatcgcatcgtcggcctcgagatgggc
gccgacgactacctgccgaagccgttcaacccgcgcgagctcgtcgcgcgcatccacgcg
gtgctgcgccgccaggcccccgccgagctgccgggcgcgccctccgagaccaccgaggtg
ttcgagttcggcgaattctcgctgaacctcgcgacgcgcacgctgacgaaatccggccag
gagattccgctcacgacgggcgaattctcggtgctgaaggtgttcgcgcgccatccgcgc
cagccgctgtcgcgcgaaaagctgatggagctcgcgcgcggccgcgaatacgaagtgttc
gaccgcagcctcgatgtgcagatctcgcgcctgcgcaagctgatcgaacccgatccgggc
agccctcgcttcatccagacggtgtggggcctcggttacgtgttcatccccgacggcgcg
gcctga

DBGET integrated database retrieval system