KEGG   Burkholderia thailandensis 2002721643: BG87_2153Help
Entry
BG87_2153         CDS       T03882                                 

Definition
(GenBank) pseudouridine synthase, RluA family protein
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
bthl  Burkholderia thailandensis 2002721643
Brite
KEGG Orthology (KO) [BR:bthl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bthl03009]
    BG87_2153
Enzymes [BR:bthl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     BG87_2153
Ribosome biogenesis [BR:bthl03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    BG87_2153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: AJY00312
Position
I:2388352..2389527
Genome map
AA seq 391 aa AA seqDB search
MTRSSSLNARAGKSNRDDYSPSASPADASAGDSLDDDLSSDTLVAPAGADAPRVVDVPPA
LAGERLDKALAQLFPEFSRSRLQQWIESERVRVDGAPAKIRQAVPLGATIELLPDLLPEQ
LAFTPEPVPLSIVYEDDTIVVVDKPAGLVVHPAAGNWSGTLLNGLLHRYADAAGLPRAGI
VHRLDKETSGLMVVARTLAAQTDLIRQLQARTVKRRYFALVWGQMPDEGTIDAPIGRDPR
ERTRMAVVTGAAGKPARTHFRTVDTTPWERQPVSAIHCDLETGRTHQIRVHCAHVGHPLL
GDPVYGRARGKRSVAPLPGGFARQALHAWRLGLVHPATGRSMQWRAPLPADLAALVDALG
FGADDAEFGDDDAVYDDGYDGGIPHADDEED
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgacccgttcaagttcgttgaatgcccgtgcgggcaagtcaaaccgcgacgattatagc
ccaagcgccagccccgccgacgcttctgcaggcgattcgctcgacgacgatctgtcgagc
gacacgctcgtcgcgcccgcgggcgccgatgcgccgcgcgtcgtcgacgtaccgcccgcg
ctcgcgggcgagcgcctcgacaaggcgctcgcgcagttgttccccgagttctctcgcagc
cgcctgcagcagtggatcgaatcggagcgtgtgcgcgtcgacggcgcgcccgcgaagatc
cggcaggccgtgccgctcggcgcgacgatcgagctgctgccggatctgctgcccgagcaa
ctcgcgttcacgccggagccggtgccgctttcgatcgtctacgaggacgatacgatcgtc
gtcgtagacaagccggccggcctcgtcgtccacccggccgccggcaactggagcggcacg
ctgctcaacggtctgctgcaccgctatgcggatgcggccggcctgccgcgcgccgggatc
gtgcatcggctcgacaaggagacgtcgggcctgatggtcgtcgcccgcacgctcgccgcg
cagacggacctgatccgccaattgcaggcgcgcacggtgaagcgccgctatttcgcgctc
gtgtgggggcagatgcccgacgaaggcacgatcgacgcgccgatcggccgcgatccgcgc
gaacgcacgcggatggcggtcgtcacgggggcggcgggcaagccggcgcgcacgcatttc
cgcaccgtcgacacgacgccgtgggagcgtcagccggtatcggcgatccattgcgatctc
gaaaccgggcgcacgcatcagatccgcgtgcattgcgcgcacgtcggacatccgttgctc
ggcgatccggtgtacggccgcgcgcgcggcaagcgctcggtcgcgccgctgccgggcggc
ttcgcgcggcaggcgctgcacgcatggcggctcggcctcgttcatccggcgaccggccgg
tcgatgcaatggcgcgcgccgctgccggccgatctcgcggcgctcgtcgatgcgctcggc
ttcggcgcggacgatgcggaattcggcgacgacgacgcggtctatgacgacggttacgat
ggaggcatcccgcatgccgacgacgaagaggattga

DBGET integrated database retrieval system