KEGG   Burkholderia thailandensis 2002721643: BG87_3210Help
Entry
BG87_3210         CDS       T03882                                 

Definition
(GenBank) S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
bthl  Burkholderia thailandensis 2002721643
Pathway
bthl00010  Glycolysis / Gluconeogenesis
bthl00071  Fatty acid degradation
bthl00350  Tyrosine metabolism
bthl00625  Chloroalkane and chloroalkene degradation
bthl00626  Naphthalene degradation
bthl00680  Methane metabolism
bthl01100  Metabolic pathways
bthl01110  Biosynthesis of secondary metabolites
bthl01120  Microbial metabolism in diverse environments
bthl01130  Biosynthesis of antibiotics
bthl01200  Carbon metabolism
bthl01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bthl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BG87_3210
  09102 Energy metabolism
   00680 Methane metabolism
    BG87_3210
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BG87_3210
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    BG87_3210
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BG87_3210
   00626 Naphthalene degradation
    BG87_3210
Enzymes [BR:bthl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BG87_3210
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     BG87_3210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 2-Hacid_dh_C TrkA_N AlaDh_PNT_C UDPG_MGDP_dh_N Met_10 RTC4 Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: AJY00271
Position
I:complement(3632917..3634023)
Genome map
AA seq 368 aa AA seqDB search
MKTKAAIAWKAGEPLTIEEVDLEGPRAGEVLIEVKATGICHTDYYTLSGADPEGLFPAIL
GHEGAGVVVDVGPGVGTLKKGDHVIPLYTPECRECKFCLSRKTNLCQKIRATQGRGLMPD
ATSRFSIGGKPIFHYMGTSTFSNYIVVPEIAVAKVREDAPFDKICYIGCGVTTGVGAVVY
SAKVEAGANVVVFGLGGIGLNVIQGARMVGADKIIGVDINPKRVELARKFGMTHFVNPNE
VENVVDHIVQLTDGGADYSFECIGNVKVMRQALECTHKGWGQSFIIGVAAAGEEISTRPF
QLVTGREWKGSAFGGARGRTDVPKIVDWYMEGKINIDDLITHTLPLEKINDGFDLMKKGE
SIRSVVLY
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgaaagccgcgatcgcctggaaggcgggcgaaccgctgacgatcgaagaggtc
gatctcgagggcccgcgcgcgggcgaggtcctgatcgaagtgaaggccaccggcatctgc
cacaccgattactacacgctgtcgggcgccgaccccgaaggcctcttcccggcgatcctc
gggcacgagggcgcgggcgtcgtggtcgacgtcgggccgggcgtcggcacgttgaagaag
ggcgatcacgtgattccgctctacacgcccgaatgccgcgagtgcaagttctgcctgtcg
cgcaagacgaacctgtgccagaagatccgcgcgacgcaagggcgcggcctgatgcccgac
gcgacgtcgcgcttctcgatcggcggcaagccgatcttccactacatgggcacgtcgacg
ttctcgaactacatcgtcgtccccgagatcgcggtggcgaaggtgcgcgaggacgcgccg
ttcgacaagatctgctacatcggctgcggcgtgacgacgggcgtgggcgccgtcgtctac
tcggcgaaggtcgaggcgggcgcgaacgtcgtcgtgttcggcctgggcggcatcggcctc
aatgtgatccagggcgcgaggatggtgggcgcggacaagatcatcggcgtcgacatcaac
ccgaagcgcgtcgagctcgcgaggaagttcgggatgacgcacttcgtcaacccgaacgag
gtcgagaacgtggtcgaccacatcgtgcagctgaccgacggcggcgccgactactcgttc
gaatgcatcggcaacgtgaaggtgatgcgccaggcgctcgagtgcacgcacaagggctgg
ggccagtcgttcatcatcggcgtcgcggcggcgggcgaggagatcagcacgcggccgttc
cagctcgtgacgggccgcgaatggaagggctccgcgttcggcggcgcgcgcgggcgcacc
gacgtgccgaagatcgtcgactggtacatggaaggcaagatcaacatcgacgacctgatc
acgcacacgctgccgctcgagaagatcaacgacggcttcgacctgatgaagaagggcgaa
tcgattcgctcggtcgtgctgtactga

DBGET integrated database retrieval system