KEGG   Burkholderia thailandensis 2002721643: BG87_3850Help
Entry
BG87_3850         CDS       T03882                                 

Definition
(GenBank) phosphoesterase family protein
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
bthl  Burkholderia thailandensis 2002721643
Pathway
bthl00562  Inositol phosphate metabolism
bthl00564  Glycerophospholipid metabolism
bthl01100  Metabolic pathways
bthl01110  Biosynthesis of secondary metabolites
bthl02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bthl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    BG87_3850
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BG87_3850
   00565 Ether lipid metabolism
    BG87_3850
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BG87_3850
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:bthl02042]
    BG87_3850
Enzymes [BR:bthl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     BG87_3850
Bacterial toxins [BR:bthl02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   BG87_3850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase
Motif
Other DBs
NCBI-ProteinID: AJY01827
Position
II:complement(581462..582853)
Genome map
AA seq 463 aa AA seqDB search
MAKILENVEHIVVVMFENRSFDTMLGWLYPPGTQPAHVLPARGSPQFDGLKPDMSNPSRA
GKTIAVTREATNNVIPDPQETFVNVTSQILGPGGAGNPWPPMQGFVVNYETTRTSDPGHV
MQCHSVAQLPTLTALARAYAVSDAWFASVPSQTWPNRAFAHAGTSNGHVNNGAIPDPLEW
DVPTIFDVLSSIGASWAVYSDTAVTPSLTHTMFPSLWNDKYADNFERFPDFVAACKNDAL
PRYAFVEPSFLFEPNDQHPPHDVLAGDKFLHDIWTAISTSPGWPRTLLVVTYDEHGGCFD
HVLPPANATPPDAASNPGDETFEFDRFGVRVPAVVVSPYIEAGTVFRSPTNVPYDHTSIL
ATLRDWLAIAPDKMLKSARIANAPTLAQLFTRSVPRGDLPAIAAPSADFVQPPPSAPLND
LQKSLVTGTSRRDGNDPAASVAPIATRQHALDFFTRRATAKPT
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaagatcctcgaaaacgtcgagcacatcgtcgtcgtgatgttcgagaaccgctcg
ttcgacacgatgctcggctggctctacccgcccggcacgcagcccgcgcacgtgctgccc
gcgcgcggctcgccgcagttcgacggcctgaagcccgacatgtcgaatccgtcgagggcg
ggcaagacgatcgccgtcacgcgcgaggcgacgaacaacgtgatccccgatccgcaggaa
accttcgtcaacgtgacgagccagatcctcggcccgggcggtgcaggcaacccgtggccg
ccgatgcagggcttcgtcgtcaattacgagacgacgcggacatccgacccgggccacgtg
atgcaatgccacagcgtcgcgcaactgccgacgctcacggcgctcgcgcgcgcgtacgcg
gtgtccgacgcgtggttcgcgtcggtgccgagccagacctggccgaaccgcgcgttcgcg
cacgcgggcacgtcgaacgggcacgtgaacaacggcgcgatccccgatccgctcgaatgg
gacgtgccgacgatcttcgacgtgctgtcgtcgatcggcgcgagctgggccgtgtacagc
gacacggccgtcacgccgtcgctcacgcacacgatgtttccgtcgctgtggaacgacaag
tacgccgacaacttcgagcgcttcccggatttcgtcgccgcgtgcaagaacgacgcgctc
ccgcggtacgcgttcgtcgagccgagcttcctgttcgagccgaacgaccagcatccgccg
cacgacgtgctcgcgggcgacaagttcctgcacgatatctggacggcgatcagcacgtcg
cccggctggccgcgcacgctgctcgtcgtcacttacgacgagcacggcggctgcttcgat
cacgtgctgccgcccgcgaacgcgacgccgcccgacgcggcgagcaaccccggcgacgag
acattcgagttcgatcgcttcggcgtgcgcgtgccggccgtcgtcgtatcgccgtacatc
gaagcgggcactgtgttccgctcgccgacgaacgtcccgtacgatcacacgtcgatcctc
gcgacgctgcgcgactggctcgccatcgcgcccgacaagatgctcaagagcgcgcggatc
gcgaacgcgccgacgctcgcgcagcttttcacgcgcagcgtgccgcgcggcgatctgccg
gcgatcgccgcgccgtcggcggacttcgtccaaccgccgccgagcgcgccgctcaacgat
ctgcagaagagcctcgtgaccggcacgtcgcggcgcgacgggaacgatccggccgcgagc
gtcgcgccgatcgcgacgcgccagcacgcgctcgatttcttcacgcgccgggcgacggcg
aagccgacatag

DBGET integrated database retrieval system