KEGG   Burkholderia thailandensis 2002721643: BG87_4376Help
Entry
BG87_4376         CDS       T03882                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
bthl  Burkholderia thailandensis 2002721643
Pathway
bthl00040  Pentose and glucuronate interconversions
bthl00053  Ascorbate and aldarate metabolism
bthl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bthl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BG87_4376
   00053 Ascorbate and aldarate metabolism
    BG87_4376
Enzymes [BR:bthl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     BG87_4376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AJY02397
Position
II:complement(1207634..1209244)
Genome map
AA seq 536 aa AA seqDB search
MNGPTGELLIDGGARRGRGAAFHAIDAATGAAIAEPVFHGALPADVEAACALADAAFDAY
RALAAARRADFLDDIAARIEALGDALIVRAMAETGLPRARLEGERARTANQLRMFAALVR
GGDALDVRIEPALPERQPPRSDLRFLRIGVGPVAVFGASNFPLAFSVAGGDTAAALAAGC
PVVVKAHPAHPGTSELVGRAVQAAVRAASLPAGVFALVADAGHEVGRALVAHPAIRAVGF
TGSRAGGLALAALAAARPVPIPVYAEMSSVNPNLMLPGALAARAEPLAREFVASVTLGCG
QFCTNPGLALGIAGAGFDAFAAAAARALRDVPAGVMLSAGILRAYEAGVARLAGHPAVDV
VARGAAGDGRAQAALLRVSARALMTDATLADEVFGPSSVLVECASADEMREAMRRLEGQL
TVTLHLSADDHDLARTLLPIVERRAGRILANGFPTGVEVCDAIVHGGPFPATSDGRGTSV
GTAAIERFQRPVCYQNVDGALLPDALRDGNPLGVPRRVGGRREAAAPRQASAGART
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgaacgggcccacgggcgaactcctgatcgacggcggcgcgcggcgcggccggggcgcg
gcgtttcacgcgatcgacgcggcgacgggcgccgcgatcgcagagccggtttttcatggc
gcgctgccggcggacgtcgaggcggcgtgcgcgctcgccgacgcggcgttcgatgcgtat
cgcgcgctcgccgccgcgcgccgcgcggattttctcgacgacatcgccgcacggatcgaa
gcgctcggcgatgcgctgatcgtgcgcgcgatggccgagaccggcttgccgcgcgcgcgg
ctcgaaggcgagcgcgcgcgcaccgcgaaccagttgcggatgttcgcggcgctcgtgcgc
ggcggcgacgcgctcgacgtgcgcatcgagcccgcgctgcccgagcggcagccgccgcgc
agcgatctgcgtttcctgcgcatcggcgtcgggccggtcgcggtgttcggcgcgagcaat
tttccgctcgcgttctcggtcgcgggcggcgatacggccgcggcgctcgcggccggctgc
ccggtcgtcgtgaaggcgcatcccgcgcatcccggcacgtccgagctcgtcgggcgcgcg
gtgcaggcggccgtgcgcgcggcgtcgctgccggccggcgtgttcgcgctcgtcgccgac
gcggggcacgaggtcggccgtgcgctcgtcgcgcatccggcgatccgcgcggtcggcttc
accggctcgcgcgcgggcggcctcgcgctcgccgcgctcgcggcggcgcggcccgtgccg
atcccggtgtacgcggagatgagcagcgtgaatccgaacctgatgctgccgggcgcgctc
gcggcgcgcgcggagccgctcgcgcgcgagttcgtcgcgtcggtcacgcttggctgcgga
cagttctgcacgaacccgggcctcgcgctcggcatcgcgggcgcgggcttcgacgcgttc
gccgccgccgccgcgcgcgcgctgcgcgacgtgccggcgggtgtgatgctgagcgcgggc
atcctgcgcgcgtacgaggcgggcgtcgcgcggctcgcgggccatccggccgtggatgtc
gtcgcgcgcggcgcggcgggcgacgggcgcgcgcaggcggcgctgctgcgcgtgagcgcg
cgcgcgctgatgaccgacgcgacgctcgccgacgaagtgttcggcccgtcgagcgtgctc
gtcgagtgcgcgagcgccgacgagatgcgcgaggcgatgcggcggctcgaagggcagttg
accgtgacgctgcacctgagcgccgacgatcacgacctcgcgcgcacgctgttgccgatc
gtcgagcgccgcgcgggacgcattctcgcgaacggctttccgacgggcgtcgaagtgtgc
gacgcgatcgtccacggcgggccgtttccggcgacgtcggacggccgcggcacgtcggtc
ggcaccgccgcgatcgagcgcttccagcggcccgtctgctaccagaacgtcgacggcgcg
ctgctgcccgacgcgctgcgcgacggcaatccgctcggggtgccgcgccgggtcggcggc
cggcgggaagccgccgcgccgcgccaggcgagcgcgggtgcgcgaacgtga

DBGET integrated database retrieval system